CsaV3_1G012250 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTGAAGAAATCAGAAGGTCTCCTAGCAAATGTCAAAAAGAAAGGTTTTGCATTTAATGTCTACCTCAAACTATATGCCAGAAATGGAAAGAAAGACGAGATACACCTTATATGGAATCTCTACAAGAAAGAGAAAATCTTCAACAAAGGTTTCATCAGCATGATAACATCACTTTTTGTATTAGACGATATCAAAGGTGCGGAGCGTATTTACAAGGAATGGGAGACCCAGAAACTGTCATACGACTTGCGGATTCCAAACTTGTTGGTTGATGCGTATTGTAGAGCTGGTCTAATGGAGAGCTGA ATGCTGAAGAAATCAGAAGGTCTCCTAGCAAATGTCAAAAAGAAAGGTTTTGCATTTAATGTCTACCTCAAACTATATGCCAGAAATGGAAAGAAAGACGAGATACACCTTATATGGAATCTCTACAAGAAAGAGAAAATCTTCAACAAAGGTTTCATCAGCATGATAACATCACTTTTTGTATTAGACGATATCAAAGGTGCGGAGCGTATTTACAAGGAATGGGAGACCCAGAAACTGTCATACGACTTGCGGATTCCAAACTTGTTGGTTGATGCGTATTGTAGAGCTGGTCTAATGGAGAGCTGA ATGCTGAAGAAATCAGAAGGTCTCCTAGCAAATGTCAAAAAGAAAGGTTTTGCATTTAATGTCTACCTCAAACTATATGCCAGAAATGGAAAGAAAGACGAGATACACCTTATATGGAATCTCTACAAGAAAGAGAAAATCTTCAACAAAGGTTTCATCAGCATGATAACATCACTTTTTGTATTAGACGATATCAAAGGTGCGGAGCGTATTTACAAGGAATGGGAGACCCAGAAACTGTCATACGACTTGCGGATTCCAAACTTGTTGGTTGATGCGTATTGTAGAGCTGGTCTAATGGAGAGCTGA MLKKSEGLLANVKKKGFAFNVYLKLYARNGKKDEIHLIWNLYKKEKIFNKGFISMITSLFVLDDIKGAERIYKEWETQKLSYDLRIPNLLVDAYCRAGLMES
BLAST of CsaV3_1G012250 vs. NCBI nr
Match: XP_011653151.1 (PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus]) HSP 1 Score: 209.1 bits (531), Expect = 6.9e-51 Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 0
BLAST of CsaV3_1G012250 vs. NCBI nr
Match: XP_011653157.1 (PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] >KGN64672.1 hypothetical protein Csa_1G073790 [Cucumis sativus]) HSP 1 Score: 203.4 bits (516), Expect = 3.8e-49 Identity = 99/101 (98.02%), Postives = 100/101 (99.01%), Query Frame = 0
BLAST of CsaV3_1G012250 vs. NCBI nr
Match: KGN64673.1 (hypothetical protein Csa_1G073800 [Cucumis sativus]) HSP 1 Score: 199.1 bits (505), Expect = 7.2e-48 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 0
BLAST of CsaV3_1G012250 vs. NCBI nr
Match: XP_008442434.1 (PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis melo]) HSP 1 Score: 183.0 bits (463), Expect = 5.3e-43 Identity = 88/101 (87.13%), Postives = 93/101 (92.08%), Query Frame = 0
BLAST of CsaV3_1G012250 vs. NCBI nr
Match: XP_008442448.1 (PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis melo]) HSP 1 Score: 159.5 bits (402), Expect = 6.3e-36 Identity = 82/107 (76.64%), Postives = 89/107 (83.18%), Query Frame = 0
BLAST of CsaV3_1G012250 vs. TAIR10
Match: AT2G20710.1 (Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 95.9 bits (237), Expect = 1.5e-20 Identity = 43/102 (42.16%), Postives = 72/102 (70.59%), Query Frame = 0
BLAST of CsaV3_1G012250 vs. TAIR10
Match: AT1G02150.1 (Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 75.1 bits (183), Expect = 2.8e-14 Identity = 39/107 (36.45%), Postives = 65/107 (60.75%), Query Frame = 0
BLAST of CsaV3_1G012250 vs. TAIR10
Match: AT1G28020.1 (Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 73.6 bits (179), Expect = 8.2e-14 Identity = 40/103 (38.83%), Postives = 60/103 (58.25%), Query Frame = 0
BLAST of CsaV3_1G012250 vs. TAIR10
Match: AT1G60770.1 (Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 69.3 bits (168), Expect = 1.6e-12 Identity = 33/95 (34.74%), Postives = 56/95 (58.95%), Query Frame = 0
BLAST of CsaV3_1G012250 vs. TAIR10
Match: AT4G21705.1 (Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 64.3 bits (155), Expect = 5.0e-11 Identity = 35/103 (33.98%), Postives = 58/103 (56.31%), Query Frame = 0
BLAST of CsaV3_1G012250 vs. Swiss-Prot
Match: sp|Q9SKU6|PP166_ARATH (Pentatricopeptide repeat-containing protein At2g20710, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g20710 PE=2 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 2.8e-19 Identity = 43/102 (42.16%), Postives = 72/102 (70.59%), Query Frame = 0
BLAST of CsaV3_1G012250 vs. Swiss-Prot
Match: sp|Q8LPS6|PPR3_ARATH (Pentatricopeptide repeat-containing protein At1g02150 OS=Arabidopsis thaliana OX=3702 GN=At1g02150 PE=2 SV=2) HSP 1 Score: 75.1 bits (183), Expect = 5.1e-13 Identity = 39/107 (36.45%), Postives = 65/107 (60.75%), Query Frame = 0
BLAST of CsaV3_1G012250 vs. Swiss-Prot
Match: sp|Q9C7F1|PPR61_ARATH (Putative pentatricopeptide repeat-containing protein At1g28020 OS=Arabidopsis thaliana OX=3702 GN=At1g28020 PE=3 SV=2) HSP 1 Score: 73.6 bits (179), Expect = 1.5e-12 Identity = 40/103 (38.83%), Postives = 60/103 (58.25%), Query Frame = 0
BLAST of CsaV3_1G012250 vs. Swiss-Prot
Match: sp|O22714|PPR86_ARATH (Pentatricopeptide repeat-containing protein At1g60770 OS=Arabidopsis thaliana OX=3702 GN=At1g60770 PE=2 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 2.8e-11 Identity = 33/95 (34.74%), Postives = 56/95 (58.95%), Query Frame = 0
BLAST of CsaV3_1G012250 vs. Swiss-Prot
Match: sp|Q84JR3|PP334_ARATH (Pentatricopeptide repeat-containing protein At4g21705, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g21705 PE=2 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 9.0e-10 Identity = 35/103 (33.98%), Postives = 58/103 (56.31%), Query Frame = 0
BLAST of CsaV3_1G012250 vs. TrEMBL
Match: tr|A0A0A0LV44|A0A0A0LV44_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G073790 PE=4 SV=1) HSP 1 Score: 203.4 bits (516), Expect = 2.5e-49 Identity = 99/101 (98.02%), Postives = 100/101 (99.01%), Query Frame = 0
BLAST of CsaV3_1G012250 vs. TrEMBL
Match: tr|A0A0A0LSC2|A0A0A0LSC2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G073800 PE=4 SV=1) HSP 1 Score: 199.1 bits (505), Expect = 4.7e-48 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 0
BLAST of CsaV3_1G012250 vs. TrEMBL
Match: tr|A0A1S3B572|A0A1S3B572_CUCME (pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like OS=Cucumis melo OX=3656 GN=LOC103486303 PE=4 SV=1) HSP 1 Score: 183.0 bits (463), Expect = 3.5e-43 Identity = 88/101 (87.13%), Postives = 93/101 (92.08%), Query Frame = 0
BLAST of CsaV3_1G012250 vs. TrEMBL
Match: tr|A0A1S3B6G4|A0A1S3B6G4_CUCME (pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like OS=Cucumis melo OX=3656 GN=LOC103486307 PE=4 SV=1) HSP 1 Score: 159.5 bits (402), Expect = 4.2e-36 Identity = 82/107 (76.64%), Postives = 89/107 (83.18%), Query Frame = 0
BLAST of CsaV3_1G012250 vs. TrEMBL
Match: tr|A0A2N9I6A5|A0A2N9I6A5_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS47431 PE=4 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 7.6e-30 Identity = 65/101 (64.36%), Postives = 84/101 (83.17%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |