Csa7G070240 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGAAAATGGCACTCGCCACCACTCTCTCTGCCCTTTGCATCGTTGCACTAGCCCTAACCCCAATCGTCATTGCTCAAAACAGCCCTCAAGACTTCTTTGACGCGCACAATGCAGTGCGAGCCAAGGTCGGGGCTGAACCCCTCTTTTGGGACGAAGAACTTGAAGCTTACGCTAAAAATTATATCACGTCGAAGATTAAAACTTGTGAAATGGTGCACTTTGTTGGCCCTTATGGTGAGAACTTGGCAACAGCGAACCCCGTGTTAACCGCAGCAGCTTCAGTGAACACATGGGCAGCCGAGAAGAAGTACTATAACCATAACTCGAACAAATGTGAGGGAGGCGAGTGCCGACATTATAGACAGTTGGTGTGGAAGAATAGTTTTTTGGTGGGTTGTGCTACTGTTAAATGCAAGAACAATTGGTCTTTAGTCTCATGCAACTATAGTCCTTCTGGGAATGTTGTAGGTGAGCGACCTTATTAG ATGTCGAAAATGGCACTCGCCACCACTCTCTCTGCCCTTTGCATCGTTGCACTAGCCCTAACCCCAATCGTCATTGCTCAAAACAGCCCTCAAGACTTCTTTGACGCGCACAATGCACTTACGCTAAAAATTATATCACGTCGAAGATTAAAACTTAATAGTTTTTTGGTGGGTTGTGCTACTGTTAAATGCAAGAACAATTGGTCTTTAGTCTCATGCAACTATAGTCCTTCTGGGAATGTTGTAGGTGAGCGACCTTATTAG ATGTCGAAAATGGCACTCGCCACCACTCTCTCTGCCCTTTGCATCGTTGCACTAGCCCTAACCCCAATCGTCATTGCTCAAAACAGCCCTCAAGACTTCTTTGACGCGCACAATGCACTTACGCTAAAAATTATATCACGTCGAAGATTAAAACTTAATAGTTTTTTGGTGGGTTGTGCTACTGTTAAATGCAAGAACAATTGGTCTTTAGTCTCATGCAACTATAGTCCTTCTGGGAATGTTGTAGGTGAGCGACCTTATTAG MSKMALATTLSALCIVALALTPIVIAQNSPQDFFDAHNALTLKIISRRRLKLNSFLVGCATVKCKNNWSLVSCNYSPSGNVVGERPY*
BLAST of Csa7G070240 vs. Swiss-Prot
Match: PR1B_TOBAC (Pathogenesis-related protein 1B OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.7e-06 Identity = 22/35 (62.86%), Postives = 23/35 (65.71%), Query Frame = 1
BLAST of Csa7G070240 vs. Swiss-Prot
Match: PR04_SOLLC (Pathogenesis-related leaf protein 4 OS=Solanum lycopersicum PE=2 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 3.0e-06 Identity = 20/35 (57.14%), Postives = 21/35 (60.00%), Query Frame = 1
BLAST of Csa7G070240 vs. Swiss-Prot
Match: PR1C_TOBAC (Pathogenesis-related protein 1C OS=Nicotiana tabacum PE=2 SV=3) HSP 1 Score: 51.6 bits (122), Expect = 5.1e-06 Identity = 21/35 (60.00%), Postives = 23/35 (65.71%), Query Frame = 1
BLAST of Csa7G070240 vs. Swiss-Prot
Match: PR06_SOLLC (Pathogenesis-related leaf protein 6 OS=Solanum lycopersicum GN=PR1B1 PE=1 SV=2) HSP 1 Score: 50.8 bits (120), Expect = 8.7e-06 Identity = 18/35 (51.43%), Postives = 21/35 (60.00%), Query Frame = 1
BLAST of Csa7G070240 vs. TrEMBL
Match: A0A0A0K2V2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G070240 PE=4 SV=1) HSP 1 Score: 176.4 bits (446), Expect = 1.5e-41 Identity = 87/87 (100.00%), Postives = 87/87 (100.00%), Query Frame = 1
BLAST of Csa7G070240 vs. TrEMBL
Match: A0A0A0K4C6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G070250 PE=3 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 1.1e-10 Identity = 30/35 (85.71%), Postives = 33/35 (94.29%), Query Frame = 1
BLAST of Csa7G070240 vs. TrEMBL
Match: A0A0A0K4C6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G070250 PE=3 SV=1) HSP 1 Score: 47.0 bits (110), Expect = 1.4e-02 Identity = 20/45 (44.44%), Postives = 34/45 (75.56%), Query Frame = 1
HSP 2 Score: 58.9 bits (141), Expect = 3.5e-06 Identity = 42/136 (30.88%), Postives = 56/136 (41.18%), Query Frame = 1
BLAST of Csa7G070240 vs. TrEMBL
Match: B9HN40_POPTR (Pathogenesis-related family protein OS=Populus trichocarpa GN=POPTR_0009s08700g PE=3 SV=2) HSP 1 Score: 58.5 bits (140), Expect = 4.6e-06 Identity = 24/35 (68.57%), Postives = 25/35 (71.43%), Query Frame = 1
BLAST of Csa7G070240 vs. TrEMBL
Match: B9HN40_POPTR (Pathogenesis-related family protein OS=Populus trichocarpa GN=POPTR_0009s08700g PE=3 SV=2) HSP 1 Score: 30.4 bits (67), Expect = 1.3e+03 Identity = 18/37 (48.65%), Postives = 24/37 (64.86%), Query Frame = 1
BLAST of Csa7G070240 vs. TAIR10
Match: AT4G33710.1 (AT4G33710.1 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein) HSP 1 Score: 48.9 bits (115), Expect = 1.9e-06 Identity = 22/35 (62.86%), Postives = 22/35 (62.86%), Query Frame = 1
BLAST of Csa7G070240 vs. TAIR10
Match: AT2G14610.1 (AT2G14610.1 pathogenesis-related gene 1) HSP 1 Score: 48.1 bits (113), Expect = 3.2e-06 Identity = 18/34 (52.94%), Postives = 22/34 (64.71%), Query Frame = 1
BLAST of Csa7G070240 vs. TAIR10
Match: AT2G14580.1 (AT2G14580.1 basic pathogenesis-related protein 1) HSP 1 Score: 47.8 bits (112), Expect = 4.1e-06 Identity = 17/35 (48.57%), Postives = 22/35 (62.86%), Query Frame = 1
BLAST of Csa7G070240 vs. TAIR10
Match: AT4G33720.1 (AT4G33720.1 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein) HSP 1 Score: 47.4 bits (111), Expect = 5.4e-06 Identity = 19/35 (54.29%), Postives = 22/35 (62.86%), Query Frame = 1
BLAST of Csa7G070240 vs. NCBI nr
Match: gi|700188595|gb|KGN43828.1| (hypothetical protein Csa_7G070240 [Cucumis sativus]) HSP 1 Score: 176.4 bits (446), Expect = 2.2e-41 Identity = 87/87 (100.00%), Postives = 87/87 (100.00%), Query Frame = 1
BLAST of Csa7G070240 vs. NCBI nr
Match: gi|449438610|ref|XP_004137081.1| (PREDICTED: basic form of pathogenesis-related protein 1-like [Cucumis sativus]) HSP 1 Score: 80.5 bits (197), Expect = 1.6e-12 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 1
BLAST of Csa7G070240 vs. NCBI nr
Match: gi|449438610|ref|XP_004137081.1| (PREDICTED: basic form of pathogenesis-related protein 1-like [Cucumis sativus]) HSP 1 Score: 75.5 bits (184), Expect = 5.2e-11 Identity = 37/41 (90.24%), Postives = 39/41 (95.12%), Query Frame = 1
HSP 2 Score: 73.9 bits (180), Expect = 1.5e-10 Identity = 30/35 (85.71%), Postives = 33/35 (94.29%), Query Frame = 1
BLAST of Csa7G070240 vs. NCBI nr
Match: gi|778724761|ref|XP_004137082.2| (PREDICTED: basic form of pathogenesis-related protein 1-like [Cucumis sativus]) HSP 1 Score: 47.0 bits (110), Expect = 2.0e-02 Identity = 20/45 (44.44%), Postives = 34/45 (75.56%), Query Frame = 1
HSP 2 Score: 72.4 bits (176), Expect = 4.4e-10 Identity = 29/35 (82.86%), Postives = 32/35 (91.43%), Query Frame = 1
BLAST of Csa7G070240 vs. NCBI nr
Match: gi|659110135|ref|XP_008455067.1| (PREDICTED: pathogenesis-related protein 1A-like [Cucumis melo]) HSP 1 Score: 51.6 bits (122), Expect = 8.1e-04 Identity = 20/44 (45.45%), Postives = 34/44 (77.27%), Query Frame = 1
HSP 2 Score: 59.7 bits (143), Expect = 3.0e-06 Identity = 24/35 (68.57%), Postives = 27/35 (77.14%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |