Csa6G516620 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGGGAAAGCCACGGCCATCATAGACCCAATACTGGCTAGAACTTGCATTGATGAAATCATGAGATGCATCCATCTAGAATTACTGTGTGTTCAAGAAAATGTAGATATCCGACCAACCATGGATTCAGTTGTTTTCATGCTCAATTGCAACTCCGTCACTCTACTTGTACCGTTGCAGCCTGGATTTTTGCTGCAGAGCAATACCTCAAACTTGCCACAGCATCTTGATGATCACACAGAAGGACCACACCATAGTCTATCTGAGAGCTTTTATGTTGAAGAAGAATCGGGAAATCAGTATTCAGCTATTGATATTCAAGCTTACTAG ATGGAAGGGAAAGCCACGGCCATCATAGACCCAATACTGGCTAGAACTTGCATTGATGAAATCATGAGATGCATCCATCTAGAATTACTGTGTGTTCAAGAAAATGTAGATATCCGACCAACCATGGATTCAGTTGTTTTCATGCTCAATTGCAACTCCGTCACTCTACTTGTACCGTTGCAGCCTGGATTTTTGCTGCAGAGCAATACCTCAAACTTGCCACAGCATCTTGATGATCACACAGAAGGACCACACCATAGTCTATCTGAGAGCTTTTATGTTGAAGAAGAATCGGGAAATCAGTATTCAGCTATTGATATTCAAGCTTACTAG ATGGAAGGGAAAGCCACGGCCATCATAGACCCAATACTGGCTAGAACTTGCATTGATGAAATCATGAGATGCATCCATCTAGAATTACTGTGTGTTCAAGAAAATGTAGATATCCGACCAACCATGGATTCAGTTGTTTTCATGCTCAATTGCAACTCCGTCACTCTACTTGTACCGTTGCAGCCTGGATTTTTGCTGCAGAGCAATACCTCAAACTTGCCACAGCATCTTGATGATCACACAGAAGGACCACACCATAGTCTATCTGAGAGCTTTTATGTTGAAGAAGAATCGGGAAATCAGTATTCAGCTATTGATATTCAAGCTTACTAG MEGKATAIIDPILARTCIDEIMRCIHLELLCVQENVDIRPTMDSVVFMLNCNSVTLLVPLQPGFLLQSNTSNLPQHLDDHTEGPHHSLSESFYVEEESGNQYSAIDIQAY*
BLAST of Csa6G516620 vs. Swiss-Prot
Match: CRK41_ARATH (Cysteine-rich receptor-like protein kinase 41 OS=Arabidopsis thaliana GN=CRK41 PE=3 SV=2) HSP 1 Score: 74.3 bits (181), Expect = 9.2e-13 Identity = 39/65 (60.00%), Postives = 42/65 (64.62%), Query Frame = 1
BLAST of Csa6G516620 vs. Swiss-Prot
Match: CRK8_ARATH (Cysteine-rich receptor-like protein kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=3 SV=2) HSP 1 Score: 73.9 bits (180), Expect = 1.2e-12 Identity = 37/78 (47.44%), Postives = 49/78 (62.82%), Query Frame = 1
BLAST of Csa6G516620 vs. Swiss-Prot
Match: Y4960_ARATH (Putative receptor-like protein kinase At4g00960 OS=Arabidopsis thaliana GN=At4g00960 PE=3 SV=2) HSP 1 Score: 72.4 bits (176), Expect = 3.5e-12 Identity = 42/85 (49.41%), Postives = 48/85 (56.47%), Query Frame = 1
BLAST of Csa6G516620 vs. Swiss-Prot
Match: CRK6_ARATH (Cysteine-rich receptor-like protein kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 6.0e-12 Identity = 36/79 (45.57%), Postives = 47/79 (59.49%), Query Frame = 1
BLAST of Csa6G516620 vs. Swiss-Prot
Match: CRK29_ARATH (Cysteine-rich receptor-like protein kinase 29 OS=Arabidopsis thaliana GN=CRK29 PE=2 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 6.0e-12 Identity = 38/82 (46.34%), Postives = 49/82 (59.76%), Query Frame = 1
BLAST of Csa6G516620 vs. TrEMBL
Match: A0A0A0KJZ9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G516620 PE=4 SV=1) HSP 1 Score: 226.5 bits (576), Expect = 1.6e-56 Identity = 110/110 (100.00%), Postives = 110/110 (100.00%), Query Frame = 1
BLAST of Csa6G516620 vs. TrEMBL
Match: A0A0A0KHX8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G516610 PE=4 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 7.1e-20 Identity = 57/102 (55.88%), Postives = 70/102 (68.63%), Query Frame = 1
BLAST of Csa6G516620 vs. TrEMBL
Match: A0A151U7H0_CAJCA (Cysteine-rich receptor-like protein kinase 29 OS=Cajanus cajan GN=KK1_007939 PE=3 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 9.0e-15 Identity = 49/103 (47.57%), Postives = 62/103 (60.19%), Query Frame = 1
BLAST of Csa6G516620 vs. TrEMBL
Match: A0A0B2QSW2_GLYSO (Cysteine-rich receptor-like protein kinase 29 OS=Glycine soja GN=glysoja_044505 PE=3 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 2.0e-14 Identity = 42/73 (57.53%), Postives = 54/73 (73.97%), Query Frame = 1
BLAST of Csa6G516620 vs. TrEMBL
Match: K7LLE4_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 3.4e-14 Identity = 42/73 (57.53%), Postives = 53/73 (72.60%), Query Frame = 1
BLAST of Csa6G516620 vs. TAIR10
Match: AT4G00970.1 (AT4G00970.1 cysteine-rich RLK (RECEPTOR-like protein kinase) 41) HSP 1 Score: 74.3 bits (181), Expect = 5.2e-14 Identity = 39/65 (60.00%), Postives = 42/65 (64.62%), Query Frame = 1
BLAST of Csa6G516620 vs. TAIR10
Match: AT4G23160.1 (AT4G23160.1 cysteine-rich RLK (RECEPTOR-like protein kinase) 8) HSP 1 Score: 73.9 bits (180), Expect = 6.8e-14 Identity = 37/78 (47.44%), Postives = 49/78 (62.82%), Query Frame = 1
BLAST of Csa6G516620 vs. TAIR10
Match: AT4G00960.1 (AT4G00960.1 Protein kinase superfamily protein) HSP 1 Score: 72.4 bits (176), Expect = 2.0e-13 Identity = 42/85 (49.41%), Postives = 48/85 (56.47%), Query Frame = 1
BLAST of Csa6G516620 vs. TAIR10
Match: AT4G21410.1 (AT4G21410.1 cysteine-rich RLK (RECEPTOR-like protein kinase) 29) HSP 1 Score: 71.6 bits (174), Expect = 3.4e-13 Identity = 38/82 (46.34%), Postives = 49/82 (59.76%), Query Frame = 1
BLAST of Csa6G516620 vs. TAIR10
Match: AT4G23140.2 (AT4G23140.2 cysteine-rich RLK (RECEPTOR-like protein kinase) 6) HSP 1 Score: 71.6 bits (174), Expect = 3.4e-13 Identity = 36/79 (45.57%), Postives = 47/79 (59.49%), Query Frame = 1
BLAST of Csa6G516620 vs. NCBI nr
Match: gi|778722551|ref|XP_011658514.1| (PREDICTED: putative receptor-like protein kinase At4g00960 [Cucumis sativus]) HSP 1 Score: 226.5 bits (576), Expect = 2.3e-56 Identity = 110/110 (100.00%), Postives = 110/110 (100.00%), Query Frame = 1
BLAST of Csa6G516620 vs. NCBI nr
Match: gi|659080992|ref|XP_008441090.1| (PREDICTED: cysteine-rich receptor-like protein kinase 29 [Cucumis melo]) HSP 1 Score: 192.2 bits (487), Expect = 4.8e-46 Identity = 93/110 (84.55%), Postives = 99/110 (90.00%), Query Frame = 1
BLAST of Csa6G516620 vs. NCBI nr
Match: gi|659080992|ref|XP_008441090.1| (PREDICTED: cysteine-rich receptor-like protein kinase 29 [Cucumis melo]) HSP 1 Score: 102.1 bits (253), Expect = 6.6e-19 Identity = 56/102 (54.90%), Postives = 68/102 (66.67%), Query Frame = 1
HSP 2 Score: 104.8 bits (260), Expect = 1.0e-19 Identity = 57/102 (55.88%), Postives = 70/102 (68.63%), Query Frame = 1
BLAST of Csa6G516620 vs. NCBI nr
Match: gi|700193949|gb|KGN49153.1| (hypothetical protein Csa_6G516610 [Cucumis sativus]) HSP 1 Score: 104.8 bits (260), Expect = 1.0e-19 Identity = 57/102 (55.88%), Postives = 70/102 (68.63%), Query Frame = 1
BLAST of Csa6G516620 vs. NCBI nr
Match: gi|743911343|ref|XP_010999534.1| (PREDICTED: cysteine-rich receptor-like protein kinase 10 [Populus euphratica]) HSP 1 Score: 88.6 bits (218), Expect = 7.5e-15 Identity = 51/108 (47.22%), Postives = 68/108 (62.96%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |