CsGy6G033490 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGGGAAAGCCACGGCCATCATAGACCCAATACTGGCTAGAACTTGCATTGATGAAATCGTGAGATGCATCCATCTAGAATTACTGTGTGTTCAAGAAAATGTAGATATCCGACCAACCATGGATTCAGTTGTTTTCATGCTCAATTGCAACTCCGTCACTCTACTTGTACCGTTGCAGCCTGGATTTTTGCTGCAGAGCAATACCTCAAACTTGCCACAGCATCTTGATGATCACACAGAAGGACCACACCATAGTCTATCTGAGAGCTTTTATGTTGAAGAAGAATCGGGAAATCAGTATTCAGCTATTGATATTCAAGCTTACTAG ATGGAAGGGAAAGCCACGGCCATCATAGACCCAATACTGGCTAGAACTTGCATTGATGAAATCGTGAGATGCATCCATCTAGAATTACTGTGTGTTCAAGAAAATGTAGATATCCGACCAACCATGGATTCAGTTGTTTTCATGCTCAATTGCAACTCCGTCACTCTACTTGTACCGTTGCAGCCTGGATTTTTGCTGCAGAGCAATACCTCAAACTTGCCACAGCATCTTGATGATCACACAGAAGGACCACACCATAGTCTATCTGAGAGCTTTTATGTTGAAGAAGAATCGGGAAATCAGTATTCAGCTATTGATATTCAAGCTTACTAG ATGGAAGGGAAAGCCACGGCCATCATAGACCCAATACTGGCTAGAACTTGCATTGATGAAATCGTGAGATGCATCCATCTAGAATTACTGTGTGTTCAAGAAAATGTAGATATCCGACCAACCATGGATTCAGTTGTTTTCATGCTCAATTGCAACTCCGTCACTCTACTTGTACCGTTGCAGCCTGGATTTTTGCTGCAGAGCAATACCTCAAACTTGCCACAGCATCTTGATGATCACACAGAAGGACCACACCATAGTCTATCTGAGAGCTTTTATGTTGAAGAAGAATCGGGAAATCAGTATTCAGCTATTGATATTCAAGCTTACTAG MEGKATAIIDPILARTCIDEIVRCIHLELLCVQENVDIRPTMDSVVFMLNCNSVTLLVPLQPGFLLQSNTSNLPQHLDDHTEGPHHSLSESFYVEEESGNQYSAIDIQAY
BLAST of CsGy6G033490 vs. NCBI nr
Match: XP_011658514.1 (PREDICTED: putative receptor-like protein kinase At4g00960 [Cucumis sativus] >KGN49154.1 hypothetical protein Csa_6G516620 [Cucumis sativus]) HSP 1 Score: 219.5 bits (558), Expect = 5.5e-54 Identity = 109/110 (99.09%), Postives = 110/110 (100.00%), Query Frame = 0
BLAST of CsGy6G033490 vs. NCBI nr
Match: XP_016899199.1 (PREDICTED: cysteine-rich receptor-like protein kinase 8 [Cucumis melo]) HSP 1 Score: 184.5 bits (467), Expect = 1.9e-43 Identity = 93/107 (86.92%), Postives = 97/107 (90.65%), Query Frame = 0
BLAST of CsGy6G033490 vs. NCBI nr
Match: XP_023544482.1 (cysteine-rich receptor-like protein kinase 29 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 154.1 bits (388), Expect = 2.8e-34 Identity = 77/102 (75.49%), Postives = 85/102 (83.33%), Query Frame = 0
BLAST of CsGy6G033490 vs. NCBI nr
Match: XP_022950182.1 (cysteine-rich receptor-like protein kinase 29 isoform X2 [Cucurbita moschata]) HSP 1 Score: 148.3 bits (373), Expect = 1.5e-32 Identity = 73/102 (71.57%), Postives = 84/102 (82.35%), Query Frame = 0
BLAST of CsGy6G033490 vs. NCBI nr
Match: XP_022950181.1 (cysteine-rich receptor-like protein kinase 26 isoform X1 [Cucurbita moschata]) HSP 1 Score: 148.3 bits (373), Expect = 1.5e-32 Identity = 73/102 (71.57%), Postives = 84/102 (82.35%), Query Frame = 0
BLAST of CsGy6G033490 vs. TAIR10
Match: AT4G23160.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 8) HSP 1 Score: 71.2 bits (173), Expect = 4.4e-13 Identity = 38/78 (48.72%), Postives = 51/78 (65.38%), Query Frame = 0
BLAST of CsGy6G033490 vs. TAIR10
Match: AT4G00970.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 41) HSP 1 Score: 70.9 bits (172), Expect = 5.7e-13 Identity = 38/65 (58.46%), Postives = 44/65 (67.69%), Query Frame = 0
BLAST of CsGy6G033490 vs. TAIR10
Match: AT4G23140.2 (cysteine-rich RLK (RECEPTOR-like protein kinase) 6) HSP 1 Score: 68.9 bits (167), Expect = 2.2e-12 Identity = 37/79 (46.84%), Postives = 49/79 (62.03%), Query Frame = 0
BLAST of CsGy6G033490 vs. TAIR10
Match: AT4G00960.1 (Protein kinase superfamily protein) HSP 1 Score: 68.6 bits (166), Expect = 2.8e-12 Identity = 42/85 (49.41%), Postives = 50/85 (58.82%), Query Frame = 0
BLAST of CsGy6G033490 vs. TAIR10
Match: AT4G21410.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 29) HSP 1 Score: 68.2 bits (165), Expect = 3.7e-12 Identity = 38/82 (46.34%), Postives = 51/82 (62.20%), Query Frame = 0
BLAST of CsGy6G033490 vs. Swiss-Prot
Match: sp|O65468|CRK8_ARATH (Cysteine-rich receptor-like protein kinase 8 OS=Arabidopsis thaliana OX=3702 GN=CRK8 PE=3 SV=2) HSP 1 Score: 71.2 bits (173), Expect = 7.9e-12 Identity = 38/78 (48.72%), Postives = 51/78 (65.38%), Query Frame = 0
BLAST of CsGy6G033490 vs. Swiss-Prot
Match: sp|O23081|CRK41_ARATH (Cysteine-rich receptor-like protein kinase 41 OS=Arabidopsis thaliana OX=3702 GN=CRK41 PE=3 SV=2) HSP 1 Score: 70.9 bits (172), Expect = 1.0e-11 Identity = 38/65 (58.46%), Postives = 44/65 (67.69%), Query Frame = 0
BLAST of CsGy6G033490 vs. Swiss-Prot
Match: sp|Q9C5S9|CRK6_ARATH (Cysteine-rich receptor-like protein kinase 6 OS=Arabidopsis thaliana OX=3702 GN=CRK6 PE=1 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 3.9e-11 Identity = 37/79 (46.84%), Postives = 49/79 (62.03%), Query Frame = 0
BLAST of CsGy6G033490 vs. Swiss-Prot
Match: sp|O23082|Y4960_ARATH (Putative receptor-like protein kinase At4g00960 OS=Arabidopsis thaliana OX=3702 GN=At4g00960 PE=3 SV=2) HSP 1 Score: 68.6 bits (166), Expect = 5.1e-11 Identity = 42/85 (49.41%), Postives = 50/85 (58.82%), Query Frame = 0
BLAST of CsGy6G033490 vs. Swiss-Prot
Match: sp|Q8GYA4|CRK10_ARATH (Cysteine-rich receptor-like protein kinase 10 OS=Arabidopsis thaliana OX=3702 GN=CRK10 PE=1 SV=3) HSP 1 Score: 68.2 bits (165), Expect = 6.7e-11 Identity = 34/77 (44.16%), Postives = 47/77 (61.04%), Query Frame = 0
BLAST of CsGy6G033490 vs. TrEMBL
Match: tr|A0A0A0KJZ9|A0A0A0KJZ9_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G516620 PE=4 SV=1) HSP 1 Score: 219.5 bits (558), Expect = 3.6e-54 Identity = 109/110 (99.09%), Postives = 110/110 (100.00%), Query Frame = 0
BLAST of CsGy6G033490 vs. TrEMBL
Match: tr|A0A1S4DT85|A0A1S4DT85_CUCME (cysteine-rich receptor-like protein kinase 8 OS=Cucumis melo OX=3656 GN=LOC107990444 PE=4 SV=1) HSP 1 Score: 184.5 bits (467), Expect = 1.3e-43 Identity = 93/107 (86.92%), Postives = 97/107 (90.65%), Query Frame = 0
BLAST of CsGy6G033490 vs. TrEMBL
Match: tr|A0A0A0KHX8|A0A0A0KHX8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G516610 PE=4 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 3.2e-18 Identity = 57/102 (55.88%), Postives = 70/102 (68.63%), Query Frame = 0
BLAST of CsGy6G033490 vs. TrEMBL
Match: tr|A0A1S4DT80|A0A1S4DT80_CUCME (cysteine-rich receptor-like protein kinase 29 OS=Cucumis melo OX=3656 GN=LOC103485317 PE=4 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 2.1e-17 Identity = 56/102 (54.90%), Postives = 68/102 (66.67%), Query Frame = 0
BLAST of CsGy6G033490 vs. TrEMBL
Match: tr|A0A0B2QSW2|A0A0B2QSW2_GLYSO (Cysteine-rich receptor-like protein kinase 29 OS=Glycine soja OX=3848 GN=glysoja_044505 PE=4 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 6.9e-13 Identity = 41/73 (56.16%), Postives = 54/73 (73.97%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |