Csa6G498420 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGACTCATGAGTGGGTGGGTGGGTTTTTGACCCATTGTGGTTGGAGCTCCAGTGTGGAAGCAATTCAGAGTCAAAAAGATTTGGTATTACTAATCATTTCTTGCAGATCAAGGAATCAATGCCAGAGTCTTGGAAGAGGAGAAGATGAGTTACTCAATTCGAAGGAATGGATTGGATGGTTCATTTACAAGAGATTATTCCATGGCAGAATCGTTGAAGTATGTAGTAGTAGAAGAAGGTAAAATTTATAGAAAGAGAATAAGAGAGATGAAGGATTTATTTGTGAATAAAGAAAAAGACGAGACATGTTAA ATGACTCATGAGTGGGTGGGTGGGTTTTTGACCCATTGTGGTTGGAGCTCCAGTGTGGAAGCAATTCAGAATCAAGGAATCAATGCCAGAGTCTTGGAAGAGGAGAAGATGAGTTACTCAATTCGAAGGAATGGATTGGATGGTTCATTTACAAGAGATTATTCCATGGCAGAATCGTTGAAGTATGTAGTAGTAGAAGAAGGTAAAATTTATAGAAAGAGAATAAGAGAGATGAAGGATTTATTTGTGAATAAAGAAAAAGACGAGACATGTTAA ATGACTCATGAGTGGGTGGGTGGGTTTTTGACCCATTGTGGTTGGAGCTCCAGTGTGGAAGCAATTCAGAATCAAGGAATCAATGCCAGAGTCTTGGAAGAGGAGAAGATGAGTTACTCAATTCGAAGGAATGGATTGGATGGTTCATTTACAAGAGATTATTCCATGGCAGAATCGTTGAAGTATGTAGTAGTAGAAGAAGGTAAAATTTATAGAAAGAGAATAAGAGAGATGAAGGATTTATTTGTGAATAAAGAAAAAGACGAGACATGTTAA MTHEWVGGFLTHCGWSSSVEAIQNQGINARVLEEEKMSYSIRRNGLDGSFTRDYSMAESLKYVVVEEGKIYRKRIREMKDLFVNKEKDETC*
BLAST of Csa6G498420 vs. Swiss-Prot
Match: U91A1_ARATH (UDP-glycosyltransferase 91A1 OS=Arabidopsis thaliana GN=UGT91A1 PE=2 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 5.3e-14 Identity = 41/102 (40.20%), Postives = 67/102 (65.69%), Query Frame = 1
BLAST of Csa6G498420 vs. Swiss-Prot
Match: U91C1_ARATH (UDP-glycosyltransferase 91C1 OS=Arabidopsis thaliana GN=UGT91C1 PE=2 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 8.4e-12 Identity = 38/101 (37.62%), Postives = 60/101 (59.41%), Query Frame = 1
BLAST of Csa6G498420 vs. Swiss-Prot
Match: URT1_FRAAN (Putative UDP-rhamnose:rhamnosyltransferase 1 OS=Fragaria ananassa GN=GT4 PE=2 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.6e-10 Identity = 43/99 (43.43%), Postives = 56/99 (56.57%), Query Frame = 1
BLAST of Csa6G498420 vs. Swiss-Prot
Match: U91B1_ARATH (UDP-glycosyltransferase 91B1 OS=Arabidopsis thaliana GN=UGT91B1 PE=2 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 6.1e-10 Identity = 41/99 (41.41%), Postives = 55/99 (55.56%), Query Frame = 1
BLAST of Csa6G498420 vs. Swiss-Prot
Match: U91D1_STERE (UDP-glycosyltransferase 91D1 OS=Stevia rebaudiana GN=UGT91D1 PE=2 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 2.3e-09 Identity = 38/95 (40.00%), Postives = 55/95 (57.89%), Query Frame = 1
BLAST of Csa6G498420 vs. TrEMBL
Match: A0A0A0KIR0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G498420 PE=4 SV=1) HSP 1 Score: 189.1 bits (479), Expect = 2.4e-45 Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 1
BLAST of Csa6G498420 vs. TrEMBL
Match: A0A0A0KLQ6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G497900 PE=4 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.4e-24 Identity = 68/100 (68.00%), Postives = 77/100 (77.00%), Query Frame = 1
BLAST of Csa6G498420 vs. TrEMBL
Match: A0A0A0KIQ5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G497390 PE=4 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.4e-24 Identity = 68/100 (68.00%), Postives = 77/100 (77.00%), Query Frame = 1
BLAST of Csa6G498420 vs. TrEMBL
Match: A0A0A0KG58_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G498430 PE=4 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 3.9e-24 Identity = 67/100 (67.00%), Postives = 77/100 (77.00%), Query Frame = 1
BLAST of Csa6G498420 vs. TrEMBL
Match: A0A0A0KGM7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G498410 PE=4 SV=1) HSP 1 Score: 118.2 bits (295), Expect = 5.1e-24 Identity = 66/102 (64.71%), Postives = 77/102 (75.49%), Query Frame = 1
BLAST of Csa6G498420 vs. TAIR10
Match: AT2G22590.1 (AT2G22590.1 UDP-Glycosyltransferase superfamily protein) HSP 1 Score: 78.2 bits (191), Expect = 3.0e-15 Identity = 41/102 (40.20%), Postives = 67/102 (65.69%), Query Frame = 1
BLAST of Csa6G498420 vs. TAIR10
Match: AT5G49690.1 (AT5G49690.1 UDP-Glycosyltransferase superfamily protein) HSP 1 Score: 70.9 bits (172), Expect = 4.8e-13 Identity = 38/101 (37.62%), Postives = 60/101 (59.41%), Query Frame = 1
BLAST of Csa6G498420 vs. TAIR10
Match: AT5G65550.1 (AT5G65550.1 UDP-Glycosyltransferase superfamily protein) HSP 1 Score: 64.7 bits (156), Expect = 3.4e-11 Identity = 41/99 (41.41%), Postives = 55/99 (55.56%), Query Frame = 1
BLAST of Csa6G498420 vs. TAIR10
Match: AT3G50740.1 (AT3G50740.1 UDP-glucosyl transferase 72E1) HSP 1 Score: 53.5 bits (127), Expect = 7.9e-08 Identity = 34/94 (36.17%), Postives = 50/94 (53.19%), Query Frame = 1
BLAST of Csa6G498420 vs. TAIR10
Match: AT5G26310.1 (AT5G26310.1 UDP-Glycosyltransferase superfamily protein) HSP 1 Score: 52.8 bits (125), Expect = 1.3e-07 Identity = 28/92 (30.43%), Postives = 50/92 (54.35%), Query Frame = 1
BLAST of Csa6G498420 vs. NCBI nr
Match: gi|700193490|gb|KGN48694.1| (hypothetical protein Csa_6G498420 [Cucumis sativus]) HSP 1 Score: 189.1 bits (479), Expect = 3.4e-45 Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 1
BLAST of Csa6G498420 vs. NCBI nr
Match: gi|659079935|ref|XP_008440525.1| (PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis melo]) HSP 1 Score: 120.6 bits (301), Expect = 1.5e-24 Identity = 69/100 (69.00%), Postives = 77/100 (77.00%), Query Frame = 1
BLAST of Csa6G498420 vs. NCBI nr
Match: gi|778718958|ref|XP_011657941.1| (PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis sativus]) HSP 1 Score: 120.2 bits (300), Expect = 1.9e-24 Identity = 68/100 (68.00%), Postives = 77/100 (77.00%), Query Frame = 1
BLAST of Csa6G498420 vs. NCBI nr
Match: gi|778718952|ref|XP_004143439.2| (PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis sativus]) HSP 1 Score: 120.2 bits (300), Expect = 1.9e-24 Identity = 68/100 (68.00%), Postives = 77/100 (77.00%), Query Frame = 1
BLAST of Csa6G498420 vs. NCBI nr
Match: gi|778718967|ref|XP_004143546.2| (PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis sativus]) HSP 1 Score: 118.6 bits (296), Expect = 5.6e-24 Identity = 67/100 (67.00%), Postives = 77/100 (77.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |