Cla97C01G017580 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAAAGAGTGTTGGAAGAGAAGATGATGGGTTACTCTGTTCCAAGGAACCAATTGAATGGTTCGTTTACAAGGGACTCAGTGCCGGAATCATTGAAACTGATAGTGGTAGAAGAAGAAGGTAAGATCTACAGAGAGAGAATAAAAGAGATGAAGGGTTTATTTGTGAAGAAAGAAAAAGACGATCTGTTAATCGACCAGTTTTTAGAGTATCACCAAACCCATAGAAAGGCAAATTAA ATGCAAAGAGTGTTGGAAGAGAAGATGATGGGTTACTCTGTTCCAAGGAACCAATTGAATGGTTCGTTTACAAGGGACTCAGTGCCGGAATCATTGAAACTGATAGTGGTAGAAGAAGAAGGTAAGATCTACAGAGAGAGAATAAAAGAGATGAAGGGTTTATTTGTGAAGAAAGAAAAAGACGATCTGTTAATCGACCAGTTTTTAGAGTATCACCAAACCCATAGAAAGGCAAATTAA ATGCAAAGAGTGTTGGAAGAGAAGATGATGGGTTACTCTGTTCCAAGGAACCAATTGAATGGTTCGTTTACAAGGGACTCAGTGCCGGAATCATTGAAACTGATAGTGGTAGAAGAAGAAGGTAAGATCTACAGAGAGAGAATAAAAGAGATGAAGGGTTTATTTGTGAAGAAAGAAAAAGACGATCTGTTAATCGACCAGTTTTTAGAGTATCACCAAACCCATAGAAAGGCAAATTAA MQRVLEEKMMGYSVPRNQLNGSFTRDSVPESLKLIVVEEEGKIYRERIKEMKGLFVKKEKDDLLIDQFLEYHQTHRKAN
BLAST of Cla97C01G017580 vs. NCBI nr
Match: XP_008440526.1 (PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis melo]) HSP 1 Score: 114.4 bits (285), Expect = 1.8e-22 Identity = 54/77 (70.13%), Postives = 67/77 (87.01%), Query Frame = 0
BLAST of Cla97C01G017580 vs. NCBI nr
Match: XP_004151488.1 (PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis sativus] >KGN48690.1 hypothetical protein Csa_6G497890 [Cucumis sativus]) HSP 1 Score: 111.7 bits (278), Expect = 1.2e-21 Identity = 52/77 (67.53%), Postives = 67/77 (87.01%), Query Frame = 0
BLAST of Cla97C01G017580 vs. NCBI nr
Match: XP_008440525.1 (PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis melo]) HSP 1 Score: 110.9 bits (276), Expect = 2.0e-21 Identity = 55/77 (71.43%), Postives = 65/77 (84.42%), Query Frame = 0
BLAST of Cla97C01G017580 vs. NCBI nr
Match: XP_011657941.1 (PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis sativus] >KGN48691.1 hypothetical protein Csa_6G497900 [Cucumis sativus]) HSP 1 Score: 110.2 bits (274), Expect = 3.4e-21 Identity = 54/74 (72.97%), Postives = 64/74 (86.49%), Query Frame = 0
BLAST of Cla97C01G017580 vs. NCBI nr
Match: XP_004143439.2 (PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis sativus] >KGN48689.1 hypothetical protein Csa_6G497390 [Cucumis sativus]) HSP 1 Score: 110.2 bits (274), Expect = 3.4e-21 Identity = 54/74 (72.97%), Postives = 64/74 (86.49%), Query Frame = 0
BLAST of Cla97C01G017580 vs. TrEMBL
Match: tr|A0A1S3B0W7|A0A1S3B0W7_CUCME (UDP-glycosyltransferase 91A1-like OS=Cucumis melo OX=3656 GN=LOC103484923 PE=4 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 1.2e-22 Identity = 54/77 (70.13%), Postives = 67/77 (87.01%), Query Frame = 0
BLAST of Cla97C01G017580 vs. TrEMBL
Match: tr|A0A0A0KG53|A0A0A0KG53_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G497890 PE=4 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 7.6e-22 Identity = 52/77 (67.53%), Postives = 67/77 (87.01%), Query Frame = 0
BLAST of Cla97C01G017580 vs. TrEMBL
Match: tr|A0A1S3B224|A0A1S3B224_CUCME (UDP-glycosyltransferase 91A1-like OS=Cucumis melo OX=3656 GN=LOC103484922 PE=4 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 1.3e-21 Identity = 55/77 (71.43%), Postives = 65/77 (84.42%), Query Frame = 0
BLAST of Cla97C01G017580 vs. TrEMBL
Match: tr|A0A0A0KLQ6|A0A0A0KLQ6_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G497900 PE=4 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 2.2e-21 Identity = 54/74 (72.97%), Postives = 64/74 (86.49%), Query Frame = 0
BLAST of Cla97C01G017580 vs. TrEMBL
Match: tr|A0A0A0KIQ5|A0A0A0KIQ5_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G497390 PE=4 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 2.2e-21 Identity = 54/74 (72.97%), Postives = 64/74 (86.49%), Query Frame = 0
BLAST of Cla97C01G017580 vs. Swiss-Prot
Match: sp|Q940V3|U91A1_ARATH (UDP-glycosyltransferase 91A1 OS=Arabidopsis thaliana OX=3702 GN=UGT91A1 PE=2 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 2.6e-17 Identity = 40/74 (54.05%), Postives = 57/74 (77.03%), Query Frame = 0
BLAST of Cla97C01G017580 vs. Swiss-Prot
Match: sp|Q66PF2|URT1_FRAAN (Putative UDP-rhamnose:rhamnosyltransferase 1 OS=Fragaria ananassa OX=3747 GN=GT4 PE=2 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 5.8e-09 Identity = 32/69 (46.38%), Postives = 44/69 (63.77%), Query Frame = 0
BLAST of Cla97C01G017580 vs. Swiss-Prot
Match: sp|D4Q9Z5|SGT3_SOYBN (Soyasaponin III rhamnosyltransferase OS=Glycine max OX=3847 GN=GmSGT3 PE=1 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 1.7e-08 Identity = 31/74 (41.89%), Postives = 46/74 (62.16%), Query Frame = 0
BLAST of Cla97C01G017580 vs. Swiss-Prot
Match: sp|Q6VAA8|U91D1_STERE (UDP-glycosyltransferase 91D1 OS=Stevia rebaudiana OX=55670 GN=UGT91D1 PE=2 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 8.4e-08 Identity = 25/76 (32.89%), Postives = 49/76 (64.47%), Query Frame = 0
BLAST of Cla97C01G017580 vs. Swiss-Prot
Match: sp|Q9LSM0|U91B1_ARATH (UDP-glycosyltransferase 91B1 OS=Arabidopsis thaliana OX=3702 GN=UGT91B1 PE=2 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 5.5e-07 Identity = 29/70 (41.43%), Postives = 42/70 (60.00%), Query Frame = 0
BLAST of Cla97C01G017580 vs. TAIR10
Match: AT2G22590.1 (UDP-Glycosyltransferase superfamily protein) HSP 1 Score: 89.0 bits (219), Expect = 1.5e-18 Identity = 40/74 (54.05%), Postives = 57/74 (77.03%), Query Frame = 0
BLAST of Cla97C01G017580 vs. TAIR10
Match: AT5G65550.1 (UDP-Glycosyltransferase superfamily protein) HSP 1 Score: 54.7 bits (130), Expect = 3.0e-08 Identity = 29/70 (41.43%), Postives = 42/70 (60.00%), Query Frame = 0
BLAST of Cla97C01G017580 vs. TAIR10
Match: AT5G49690.1 (UDP-Glycosyltransferase superfamily protein) HSP 1 Score: 48.1 bits (113), Expect = 2.8e-06 Identity = 22/69 (31.88%), Postives = 44/69 (63.77%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |