Csa6G453270 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGAATTATTTGATTCCTGGGTTTAGGTTTTACCCAACTGAAGAAGAGTTGATTTCATTCTATTTGCAACACAAGCTTGAAGACGATGGAGACGATGATTTGAAACAAGCGATGGATCAAATCATACCTATTTTGGATATTTATAATTTCAATCCTTGGGATCTTCCACGTATTTATTTTTATTTTTCTCCATCTTCATCTCATCTTATATTATTATATGTTCATATCAATTTTTCTTTTGTCAATCTTTTTTTATTTGTTCATGTGATTGTTATATTTGGGAAGACGTTGTATGTTTCTTTTAGATAATTAAAATGGTTAACACAAAGAAAGAATTTTAGAATATATATTATATTGTAGGGAATTTGCAAGTAATAATGAAGGGTTTCTAG ATGGAGAATTATTTGATTCCTGGGTTTAGGTTTTACCCAACTGAAGAAGAGTTGATTTCATTCTATTTGCAACACAAGCTTGAAGACGATGGAGACGATGATTTGAAACAAGCGATGGATCAAATCATACCTATTTTGGATATTTATAATTTCAATCCTTGGGATCTTCCACGGAATTTGCAAGTAATAATGAAGGGTTTCTAG ATGGAGAATTATTTGATTCCTGGGTTTAGGTTTTACCCAACTGAAGAAGAGTTGATTTCATTCTATTTGCAACACAAGCTTGAAGACGATGGAGACGATGATTTGAAACAAGCGATGGATCAAATCATACCTATTTTGGATATTTATAATTTCAATCCTTGGGATCTTCCACGGAATTTGCAAGTAATAATGAAGGGTTTCTAG MENYLIPGFRFYPTEEELISFYLQHKLEDDGDDDLKQAMDQIIPILDIYNFNPWDLPRNLQVIMKGF*
BLAST of Csa6G453270 vs. Swiss-Prot
Match: FEZ_ARATH (Protein FEZ OS=Arabidopsis thaliana GN=FEZ PE=2 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 1.7e-09 Identity = 28/58 (48.28%), Postives = 40/58 (68.97%), Query Frame = 1
BLAST of Csa6G453270 vs. Swiss-Prot
Match: NAC90_ARATH (NAC domain-containing protein 90 OS=Arabidopsis thaliana GN=NAC090 PE=2 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 8.4e-09 Identity = 29/59 (49.15%), Postives = 38/59 (64.41%), Query Frame = 1
BLAST of Csa6G453270 vs. Swiss-Prot
Match: NAC35_ARATH (NAC domain-containing protein 35 OS=Arabidopsis thaliana GN=NAC035 PE=1 SV=2) HSP 1 Score: 58.5 bits (140), Expect = 3.2e-08 Identity = 26/53 (49.06%), Postives = 36/53 (67.92%), Query Frame = 1
BLAST of Csa6G453270 vs. Swiss-Prot
Match: NAC42_ARATH (Transcription factor JUNGBRUNNEN 1 OS=Arabidopsis thaliana GN=JUB1 PE=1 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 4.2e-08 Identity = 25/53 (47.17%), Postives = 36/53 (67.92%), Query Frame = 1
BLAST of Csa6G453270 vs. Swiss-Prot
Match: NAC89_ARATH (NAC domain-containing protein 89 OS=Arabidopsis thaliana GN=NAC089 PE=1 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 4.2e-08 Identity = 27/53 (50.94%), Postives = 38/53 (71.70%), Query Frame = 1
BLAST of Csa6G453270 vs. TrEMBL
Match: A0A0A0KIQ7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G453270 PE=4 SV=1) HSP 1 Score: 144.8 bits (364), Expect = 3.8e-32 Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 1
BLAST of Csa6G453270 vs. TrEMBL
Match: W6J901_GOSHI (NAC domain protein NAC70 OS=Gossypium hirsutum PE=2 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.1e-15 Identity = 38/52 (73.08%), Postives = 44/52 (84.62%), Query Frame = 1
BLAST of Csa6G453270 vs. TrEMBL
Match: A0A0D2NS40_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G238300 PE=4 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.1e-15 Identity = 38/52 (73.08%), Postives = 44/52 (84.62%), Query Frame = 1
BLAST of Csa6G453270 vs. TrEMBL
Match: A0A0M5JKG8_MANES (NAC transcription factors 80 OS=Manihot esculenta PE=2 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 4.7e-14 Identity = 36/53 (67.92%), Postives = 46/53 (86.79%), Query Frame = 1
BLAST of Csa6G453270 vs. TrEMBL
Match: A0A0A0KKJ2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G452770 PE=4 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 6.1e-14 Identity = 41/59 (69.49%), Postives = 47/59 (79.66%), Query Frame = 1
BLAST of Csa6G453270 vs. TAIR10
Match: AT1G26870.1 (AT1G26870.1 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein) HSP 1 Score: 62.8 bits (151), Expect = 9.6e-11 Identity = 28/58 (48.28%), Postives = 40/58 (68.97%), Query Frame = 1
BLAST of Csa6G453270 vs. TAIR10
Match: AT5G22380.1 (AT5G22380.1 NAC domain containing protein 90) HSP 1 Score: 60.5 bits (145), Expect = 4.8e-10 Identity = 29/59 (49.15%), Postives = 38/59 (64.41%), Query Frame = 1
BLAST of Csa6G453270 vs. TAIR10
Match: AT1G32510.1 (AT1G32510.1 NAC domain containing protein 11) HSP 1 Score: 59.7 bits (143), Expect = 8.1e-10 Identity = 26/55 (47.27%), Postives = 39/55 (70.91%), Query Frame = 1
BLAST of Csa6G453270 vs. TAIR10
Match: AT5G46590.1 (AT5G46590.1 NAC domain containing protein 96) HSP 1 Score: 58.9 bits (141), Expect = 1.4e-09 Identity = 25/53 (47.17%), Postives = 37/53 (69.81%), Query Frame = 1
BLAST of Csa6G453270 vs. TAIR10
Match: AT4G17980.1 (AT4G17980.1 NAC domain containing protein 71) HSP 1 Score: 58.5 bits (140), Expect = 1.8e-09 Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 1
BLAST of Csa6G453270 vs. NCBI nr
Match: gi|700193073|gb|KGN48277.1| (hypothetical protein Csa_6G453270 [Cucumis sativus]) HSP 1 Score: 144.8 bits (364), Expect = 5.4e-32 Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 1
BLAST of Csa6G453270 vs. NCBI nr
Match: gi|449451277|ref|XP_004143388.1| (PREDICTED: NAC domain-containing protein 90-like [Cucumis sativus]) HSP 1 Score: 125.9 bits (315), Expect = 2.6e-26 Identity = 57/58 (98.28%), Postives = 58/58 (100.00%), Query Frame = 1
BLAST of Csa6G453270 vs. NCBI nr
Match: gi|659125406|ref|XP_008462671.1| (PREDICTED: NAC domain-containing protein 90-like [Cucumis melo]) HSP 1 Score: 115.9 bits (289), Expect = 2.7e-23 Identity = 52/58 (89.66%), Postives = 55/58 (94.83%), Query Frame = 1
BLAST of Csa6G453270 vs. NCBI nr
Match: gi|823136783|ref|XP_012468159.1| (PREDICTED: NAC domain-containing protein 90-like [Gossypium raimondii]) HSP 1 Score: 90.1 bits (222), Expect = 1.6e-15 Identity = 38/52 (73.08%), Postives = 44/52 (84.62%), Query Frame = 1
BLAST of Csa6G453270 vs. NCBI nr
Match: gi|470135457|ref|XP_004303531.1| (PREDICTED: NAC domain-containing protein 90-like [Fragaria vesca subsp. vesca]) HSP 1 Score: 87.4 bits (215), Expect = 1.0e-14 Identity = 41/60 (68.33%), Postives = 46/60 (76.67%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |