CsGy6G025160 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGAATTATTTGATTCCTGGGTTTAGGTTTTACCCAACTGAAGAAGAGTTGATTTCATTCTATTTGCAACACAAGCTTGAAGACGATGGAGACGATGATTTGAAACAAGCGATGGATCAAATCATACCTATTTTGGATATTTATAATTTCAATCCTTGGGATCTTCCACGTATTTATTTTTATTTTTCTCCATCTTCATCTCATCTTATATTATTATATGTTCATATCAATTTTTCTTTTGTCAATCTTTTTTTATTTGTTCATGTGATTGTTATATTTGGGAAGACGTTGTATGTTTCTTTTAGATAATTAAAATGGTTAACACAAAGAAAGAATTTTAGAATATATATTATATTGTAGGGAATTTGCAAGTAATAATGAAGGGTTTCTAG ATGGAGAATTATTTGATTCCTGGGTTTAGGTTTTACCCAACTGAAGAAGAGTTGATTTCATTCTATTTGCAACACAAGCTTGAAGACGATGGAGACGATGATTTGAAACAAGCGATGGATCAAATCATACCTATTTTGGATATTTATAATTTCAATCCTTGGGATCTTCCACGGAATTTGCAAGTAATAATGAAGGGTTTCTAG ATGGAGAATTATTTGATTCCTGGGTTTAGGTTTTACCCAACTGAAGAAGAGTTGATTTCATTCTATTTGCAACACAAGCTTGAAGACGATGGAGACGATGATTTGAAACAAGCGATGGATCAAATCATACCTATTTTGGATATTTATAATTTCAATCCTTGGGATCTTCCACGGAATTTGCAAGTAATAATGAAGGGTTTCTAG MENYLIPGFRFYPTEEELISFYLQHKLEDDGDDDLKQAMDQIIPILDIYNFNPWDLPRNLQVIMKGF
BLAST of CsGy6G025160 vs. NCBI nr
Match: KGN48277.1 (hypothetical protein Csa_6G453270 [Cucumis sativus]) HSP 1 Score: 146.0 bits (367), Expect = 4.7e-32 Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 0
BLAST of CsGy6G025160 vs. NCBI nr
Match: XP_004143388.1 (PREDICTED: NAC domain-containing protein 90-like [Cucumis sativus]) HSP 1 Score: 126.3 bits (316), Expect = 3.8e-26 Identity = 57/58 (98.28%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of CsGy6G025160 vs. NCBI nr
Match: XP_008462671.1 (PREDICTED: NAC domain-containing protein 90-like [Cucumis melo]) HSP 1 Score: 116.3 bits (290), Expect = 4.0e-23 Identity = 52/58 (89.66%), Postives = 55/58 (94.83%), Query Frame = 0
BLAST of CsGy6G025160 vs. NCBI nr
Match: XP_022972710.1 (NAC domain-containing protein 90-like [Cucurbita maxima]) HSP 1 Score: 105.5 bits (262), Expect = 7.0e-20 Identity = 50/58 (86.21%), Postives = 52/58 (89.66%), Query Frame = 0
BLAST of CsGy6G025160 vs. NCBI nr
Match: XP_023518842.1 (NAC domain-containing protein 90-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 105.5 bits (262), Expect = 7.0e-20 Identity = 50/58 (86.21%), Postives = 52/58 (89.66%), Query Frame = 0
BLAST of CsGy6G025160 vs. TAIR10
Match: AT1G26870.1 (NAC (No Apical Meristem) domain transcriptional regulator superfamily protein) HSP 1 Score: 63.5 bits (153), Expect = 5.5e-11 Identity = 28/58 (48.28%), Postives = 42/58 (72.41%), Query Frame = 0
BLAST of CsGy6G025160 vs. TAIR10
Match: AT5G22380.1 (NAC domain containing protein 90) HSP 1 Score: 61.2 bits (147), Expect = 2.7e-10 Identity = 29/59 (49.15%), Postives = 40/59 (67.80%), Query Frame = 0
BLAST of CsGy6G025160 vs. TAIR10
Match: AT3G12910.1 (NAC (No Apical Meristem) domain transcriptional regulator superfamily protein) HSP 1 Score: 60.1 bits (144), Expect = 6.1e-10 Identity = 27/56 (48.21%), Postives = 40/56 (71.43%), Query Frame = 0
BLAST of CsGy6G025160 vs. TAIR10
Match: AT1G32510.1 (NAC domain containing protein 11) HSP 1 Score: 59.7 bits (143), Expect = 8.0e-10 Identity = 26/55 (47.27%), Postives = 41/55 (74.55%), Query Frame = 0
BLAST of CsGy6G025160 vs. TAIR10
Match: AT5G46590.1 (NAC domain containing protein 96) HSP 1 Score: 59.7 bits (143), Expect = 8.0e-10 Identity = 25/53 (47.17%), Postives = 39/53 (73.58%), Query Frame = 0
BLAST of CsGy6G025160 vs. Swiss-Prot
Match: sp|Q9ZVH0|FEZ_ARATH (Protein FEZ OS=Arabidopsis thaliana OX=3702 GN=FEZ PE=2 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.0e-09 Identity = 28/58 (48.28%), Postives = 42/58 (72.41%), Query Frame = 0
BLAST of CsGy6G025160 vs. Swiss-Prot
Match: sp|Q9FMR3|NAC90_ARATH (NAC domain-containing protein 90 OS=Arabidopsis thaliana OX=3702 GN=NAC090 PE=1 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 5.0e-09 Identity = 29/59 (49.15%), Postives = 40/59 (67.80%), Query Frame = 0
BLAST of CsGy6G025160 vs. Swiss-Prot
Match: sp|Q9LS24|NAC96_ARATH (NAC domain-containing protein 96 OS=Arabidopsis thaliana OX=3702 GN=NAC096 PE=1 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 1.4e-08 Identity = 25/53 (47.17%), Postives = 39/53 (73.58%), Query Frame = 0
BLAST of CsGy6G025160 vs. Swiss-Prot
Match: sp|Q9ZVP8|NAC35_ARATH (NAC domain-containing protein 35 OS=Arabidopsis thaliana OX=3702 GN=NAC035 PE=1 SV=2) HSP 1 Score: 59.3 bits (142), Expect = 1.9e-08 Identity = 26/53 (49.06%), Postives = 38/53 (71.70%), Query Frame = 0
BLAST of CsGy6G025160 vs. Swiss-Prot
Match: sp|Q9SK55|NAC42_ARATH (Transcription factor JUNGBRUNNEN 1 OS=Arabidopsis thaliana OX=3702 GN=JUB1 PE=1 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 1.9e-08 Identity = 25/53 (47.17%), Postives = 38/53 (71.70%), Query Frame = 0
BLAST of CsGy6G025160 vs. TrEMBL
Match: tr|A0A0A0KIQ7|A0A0A0KIQ7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G453270 PE=4 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 3.1e-32 Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 0
BLAST of CsGy6G025160 vs. TrEMBL
Match: tr|A0A1S3CHI8|A0A1S3CHI8_CUCME (NAC domain-containing protein 90-like OS=Cucumis melo OX=3656 GN=LOC103500974 PE=4 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 2.6e-23 Identity = 52/58 (89.66%), Postives = 55/58 (94.83%), Query Frame = 0
BLAST of CsGy6G025160 vs. TrEMBL
Match: tr|A0A2I0ISR1|A0A2I0ISR1_PUNGR (Uncharacterized protein OS=Punica granatum OX=22663 GN=CRG98_032584 PE=4 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 6.9e-16 Identity = 42/60 (70.00%), Postives = 47/60 (78.33%), Query Frame = 0
BLAST of CsGy6G025160 vs. TrEMBL
Match: tr|A0A2P5STX4|A0A2P5STX4_GOSBA (Uncharacterized protein OS=Gossypium barbadense OX=3634 GN=GOBAR_DD00505 PE=4 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 9.0e-16 Identity = 40/59 (67.80%), Postives = 49/59 (83.05%), Query Frame = 0
BLAST of CsGy6G025160 vs. TrEMBL
Match: tr|A0A1U8LJP9|A0A1U8LJP9_GOSHI (NAC domain-containing protein 90-like OS=Gossypium hirsutum OX=3635 GN=LOC107928166 PE=4 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.5e-15 Identity = 38/52 (73.08%), Postives = 44/52 (84.62%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |