Csa6G404130 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTAAGTATGTTCATCCCTAAATTCCTTTATGAAAGTCATTGTATAGCTAGGGTCATAAAAATTTCAATAATACGTATCTTACTGAATGAAATTGGTTGGATATGTAGGAAGCCGTGAAGGAGGAGAGCGACGGGAGCATATGGGAAGGGTATGTGGATTGGCGGAAGAGGCCTGCAGCCAAAGGGCGGCATGGGGGAATGATAGCGGCTGGATTCGTATTAGGTTGGTGAATACATACTACATACATACATGCATGCATGTTAGATAATAATGAGTAAACATTTTGATTGAGAGTTAAATTTGGTATTAATTAACTATTATTGCAGGAGTTGAAGTGTTGGAGAATTTGGCGTTCTTGGCAAACGCAAGTAATTTGGTGATGTATTTGAGGAAATATATGGGATTTTCACCGGCGAAATCGGCCAACCATGTCACGACGTTTATGGGAACGGCGTTTCTTCTTGCACTTCTTGGTGGTTTCTTATCGGATGCCATTTTCACAACTTATTACGTCTTCATTTTCTCCTCTTTCATTGAGTTTCTGGTTCGTCTTATTTAA ATGGAAGCCGTGAAGGAGGAGAGCGACGGGAGCATATGGGAAGGGTATGTGGATTGGCGGAAGAGGCCTGCAGCCAAAGGGCGGCATGGGGGAATGATAGCGGCTGGATTCGTATTAGGAGTTGAAGTGTTGGAGAATTTGGCGTTCTTGGCAAACGCAAGTAATTTGGTGATGTATTTGAGGAAATATATGGGATTTTCACCGGCGAAATCGGCCAACCATGTCACGACGTTTATGGGAACGGCGTTTCTTCTTGCACTTCTTGGTGGTTTCTTATCGGATGCCATTTTCACAACTTATTACGTCTTCATTTTCTCCTCTTTCATTGAGTTTCTGGTTCGTCTTATTTAA ATGGAAGCCGTGAAGGAGGAGAGCGACGGGAGCATATGGGAAGGGTATGTGGATTGGCGGAAGAGGCCTGCAGCCAAAGGGCGGCATGGGGGAATGATAGCGGCTGGATTCGTATTAGGAGTTGAAGTGTTGGAGAATTTGGCGTTCTTGGCAAACGCAAGTAATTTGGTGATGTATTTGAGGAAATATATGGGATTTTCACCGGCGAAATCGGCCAACCATGTCACGACGTTTATGGGAACGGCGTTTCTTCTTGCACTTCTTGGTGGTTTCTTATCGGATGCCATTTTCACAACTTATTACGTCTTCATTTTCTCCTCTTTCATTGAGTTTCTGGTTCGTCTTATTTAA MEAVKEESDGSIWEGYVDWRKRPAAKGRHGGMIAAGFVLGVEVLENLAFLANASNLVMYLRKYMGFSPAKSANHVTTFMGTAFLLALLGGFLSDAIFTTYYVFIFSSFIEFLVRLI*
BLAST of Csa6G404130 vs. Swiss-Prot
Match: PTR19_ARATH (Protein NRT1/ PTR FAMILY 4.6 OS=Arabidopsis thaliana GN=NPF4.6 PE=1 SV=1) HSP 1 Score: 160.2 bits (404), Expect = 1.3e-38 Identity = 78/110 (70.91%), Postives = 89/110 (80.91%), Query Frame = 1
BLAST of Csa6G404130 vs. Swiss-Prot
Match: PTR54_ARATH (Protein NRT1/ PTR FAMILY 4.7 OS=Arabidopsis thaliana GN=NPF4.7 PE=2 SV=2) HSP 1 Score: 156.0 bits (393), Expect = 2.5e-37 Identity = 76/111 (68.47%), Postives = 88/111 (79.28%), Query Frame = 1
BLAST of Csa6G404130 vs. Swiss-Prot
Match: PTR12_ARATH (Protein NRT1/ PTR FAMILY 4.5 OS=Arabidopsis thaliana GN=NPF4.5 PE=2 SV=1) HSP 1 Score: 149.1 bits (375), Expect = 3.1e-35 Identity = 71/109 (65.14%), Postives = 86/109 (78.90%), Query Frame = 1
BLAST of Csa6G404130 vs. Swiss-Prot
Match: PTR16_ARATH (Protein NRT1/ PTR FAMILY 4.3 OS=Arabidopsis thaliana GN=NPF4.3 PE=2 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 7.7e-18 Identity = 48/110 (43.64%), Postives = 66/110 (60.00%), Query Frame = 1
BLAST of Csa6G404130 vs. Swiss-Prot
Match: PTR34_ARATH (Protein NRT1/ PTR FAMILY 4.1 OS=Arabidopsis thaliana GN=NPF4.1 PE=2 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 7.7e-18 Identity = 43/99 (43.43%), Postives = 60/99 (60.61%), Query Frame = 1
BLAST of Csa6G404130 vs. TrEMBL
Match: A0A0A0KE15_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G404130 PE=4 SV=1) HSP 1 Score: 232.6 bits (592), Expect = 2.4e-58 Identity = 116/116 (100.00%), Postives = 116/116 (100.00%), Query Frame = 1
BLAST of Csa6G404130 vs. TrEMBL
Match: A0A072TSL8_MEDTR (Peptide/nitrate transporter plant OS=Medicago truncatula GN=MTR_8g469310 PE=4 SV=1) HSP 1 Score: 171.4 bits (433), Expect = 6.5e-40 Identity = 82/107 (76.64%), Postives = 94/107 (87.85%), Query Frame = 1
BLAST of Csa6G404130 vs. TrEMBL
Match: A0A087HH02_ARAAL (Uncharacterized protein OS=Arabis alpina GN=AALP_AA2G126500 PE=4 SV=1) HSP 1 Score: 168.7 bits (426), Expect = 4.2e-39 Identity = 81/113 (71.68%), Postives = 94/113 (83.19%), Query Frame = 1
BLAST of Csa6G404130 vs. TrEMBL
Match: A0A0B0MSN6_GOSAR (Nitrate transporter 1.2-like protein OS=Gossypium arboreum GN=F383_25809 PE=4 SV=1) HSP 1 Score: 166.4 bits (420), Expect = 2.1e-38 Identity = 80/104 (76.92%), Postives = 90/104 (86.54%), Query Frame = 1
BLAST of Csa6G404130 vs. TrEMBL
Match: A0A0D2T2L6_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G183100 PE=4 SV=1) HSP 1 Score: 164.5 bits (415), Expect = 7.9e-38 Identity = 79/104 (75.96%), Postives = 89/104 (85.58%), Query Frame = 1
BLAST of Csa6G404130 vs. TAIR10
Match: AT1G69850.1 (AT1G69850.1 nitrate transporter 1:2) HSP 1 Score: 160.2 bits (404), Expect = 7.6e-40 Identity = 78/110 (70.91%), Postives = 89/110 (80.91%), Query Frame = 1
BLAST of Csa6G404130 vs. TAIR10
Match: AT5G62730.1 (AT5G62730.1 Major facilitator superfamily protein) HSP 1 Score: 156.0 bits (393), Expect = 1.4e-38 Identity = 76/111 (68.47%), Postives = 88/111 (79.28%), Query Frame = 1
BLAST of Csa6G404130 vs. TAIR10
Match: AT1G27040.1 (AT1G27040.1 Major facilitator superfamily protein) HSP 1 Score: 149.1 bits (375), Expect = 1.7e-36 Identity = 71/109 (65.14%), Postives = 86/109 (78.90%), Query Frame = 1
BLAST of Csa6G404130 vs. TAIR10
Match: AT1G59740.1 (AT1G59740.1 Major facilitator superfamily protein) HSP 1 Score: 91.3 bits (225), Expect = 4.3e-19 Identity = 48/110 (43.64%), Postives = 66/110 (60.00%), Query Frame = 1
BLAST of Csa6G404130 vs. TAIR10
Match: AT3G25280.1 (AT3G25280.1 Major facilitator superfamily protein) HSP 1 Score: 91.3 bits (225), Expect = 4.3e-19 Identity = 44/99 (44.44%), Postives = 60/99 (60.61%), Query Frame = 1
BLAST of Csa6G404130 vs. NCBI nr
Match: gi|700192594|gb|KGN47798.1| (hypothetical protein Csa_6G404130 [Cucumis sativus]) HSP 1 Score: 232.6 bits (592), Expect = 3.4e-58 Identity = 116/116 (100.00%), Postives = 116/116 (100.00%), Query Frame = 1
BLAST of Csa6G404130 vs. NCBI nr
Match: gi|778715931|ref|XP_011657481.1| (PREDICTED: protein NRT1/ PTR FAMILY 4.6-like [Cucumis sativus]) HSP 1 Score: 226.1 bits (575), Expect = 3.2e-56 Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 1
BLAST of Csa6G404130 vs. NCBI nr
Match: gi|659113213|ref|XP_008456458.1| (PREDICTED: protein NRT1/ PTR FAMILY 4.6-like [Cucumis melo]) HSP 1 Score: 220.7 bits (561), Expect = 1.3e-54 Identity = 107/112 (95.54%), Postives = 110/112 (98.21%), Query Frame = 1
BLAST of Csa6G404130 vs. NCBI nr
Match: gi|922335654|ref|XP_013445817.1| (peptide/nitrate transporter plant [Medicago truncatula]) HSP 1 Score: 171.4 bits (433), Expect = 9.3e-40 Identity = 82/107 (76.64%), Postives = 94/107 (87.85%), Query Frame = 1
BLAST of Csa6G404130 vs. NCBI nr
Match: gi|674248639|gb|KFK41404.1| (hypothetical protein AALP_AA2G126500 [Arabis alpina]) HSP 1 Score: 168.7 bits (426), Expect = 6.0e-39 Identity = 81/113 (71.68%), Postives = 94/113 (83.19%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|