Csa6G041150 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATTTTCTCATTCTCTCTTTTGCATCATTTTAGCCTCATCTAGCATCTCTAACCTCCGATTCTAAAGCTCTTTCTGTTATTACAATTCCACATTACAAAATCCAGTCCAAAGAAGCACAAAGAATATAAAACAATACCAAAAGAAAAGAAAAAATGGCAGACTCAGATGGAAACAGAATGGAATGCGAGCGAATCTTTAAGCGGTTCGATGTCAACGGAGACGGAAAGATCTCGCTATCGGAGCTTGAGGCTGCTCTGCACGCCCTTGGCTCCTCTGCGCCGGAAGAGGTTGGACGACGAATGTCGGAGATCGACAAGGACGGAAACGGTTACATTTCGCTTGAGGAACTCTGTGATTTTCAGAGGGCTAATCCTGATTTGATGAAGGAGGTTTGCAAGAGGCTTTAGGTTTGTTGAATTGGAATTCAGAATGTGATTGTAAAATTTTCTCCATTGTGCTCTAATTCTTTGTTTGTGATGTGTTTC ATGGCAGACTCAGATGGAAACAGAATGGAATGCGAGCGAATCTTTAAGCGGTTCGATGTCAACGGAGACGGAAAGATCTCGCTATCGGAGCTTGAGGCTGCTCTGCACGCCCTTGGCTCCTCTGCGCCGGAAGAGGTTGGACGACGAATGTCGGAGATCGACAAGGACGGAAACGGTTACATTTCGCTTGAGGAACTCTGTGATTTTCAGAGGGCTAATCCTGATTTGATGAAGGAGGTTTGCAAGAGGCTTTAG ATGGCAGACTCAGATGGAAACAGAATGGAATGCGAGCGAATCTTTAAGCGGTTCGATGTCAACGGAGACGGAAAGATCTCGCTATCGGAGCTTGAGGCTGCTCTGCACGCCCTTGGCTCCTCTGCGCCGGAAGAGGTTGGACGACGAATGTCGGAGATCGACAAGGACGGAAACGGTTACATTTCGCTTGAGGAACTCTGTGATTTTCAGAGGGCTAATCCTGATTTGATGAAGGAGGTTTGCAAGAGGCTTTAG MADSDGNRMECERIFKRFDVNGDGKISLSELEAALHALGSSAPEEVGRRMSEIDKDGNGYISLEELCDFQRANPDLMKEVCKRL*
BLAST of Csa6G041150 vs. Swiss-Prot
Match: POLC3_SYRVU (Polcalcin Syr v 3 OS=Syringa vulgaris GN=SYRV3 PE=1 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 1.5e-18 Identity = 47/73 (64.38%), Postives = 52/73 (71.23%), Query Frame = 1
BLAST of Csa6G041150 vs. Swiss-Prot
Match: ALL3_OLEEU (Polcalcin Ole e 3 OS=Olea europaea GN=OLE3 PE=1 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 2.5e-18 Identity = 49/82 (59.76%), Postives = 54/82 (65.85%), Query Frame = 1
BLAST of Csa6G041150 vs. Swiss-Prot
Match: POLC4_BETPN (Polcalcin Bet v 4 OS=Betula pendula GN=BETV4 PE=1 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 5.6e-18 Identity = 46/80 (57.50%), Postives = 55/80 (68.75%), Query Frame = 1
BLAST of Csa6G041150 vs. Swiss-Prot
Match: POLC7_PHLPR (Polcalcin Phl p 7 OS=Phleum pratense PE=1 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 7.3e-18 Identity = 45/73 (61.64%), Postives = 51/73 (69.86%), Query Frame = 1
BLAST of Csa6G041150 vs. Swiss-Prot
Match: POLC3_CHEAL (Polcalcin Che a 3 OS=Chenopodium album PE=1 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 7.3e-18 Identity = 46/71 (64.79%), Postives = 52/71 (73.24%), Query Frame = 1
BLAST of Csa6G041150 vs. TrEMBL
Match: A0A0A0KAW9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G041150 PE=4 SV=1) HSP 1 Score: 172.2 bits (435), Expect = 2.8e-40 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 1
BLAST of Csa6G041150 vs. TrEMBL
Match: W9RDJ1_9ROSA (Polcalcin Syr v 3 OS=Morus notabilis GN=L484_006237 PE=4 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 6.9e-23 Identity = 56/84 (66.67%), Postives = 69/84 (82.14%), Query Frame = 1
BLAST of Csa6G041150 vs. TrEMBL
Match: M5X4D6_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa019115mg PE=4 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 8.9e-23 Identity = 59/84 (70.24%), Postives = 68/84 (80.95%), Query Frame = 1
BLAST of Csa6G041150 vs. TrEMBL
Match: I1KRQ2_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_08G093000 PE=4 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.1e-20 Identity = 52/77 (67.53%), Postives = 61/77 (79.22%), Query Frame = 1
BLAST of Csa6G041150 vs. TrEMBL
Match: A0A0B2R128_GLYSO (Polcalcin Phl p 7 OS=Glycine soja GN=glysoja_018828 PE=4 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 5.4e-20 Identity = 51/77 (66.23%), Postives = 61/77 (79.22%), Query Frame = 1
BLAST of Csa6G041150 vs. TAIR10
Match: AT3G03430.1 (AT3G03430.1 Calcium-binding EF-hand family protein) HSP 1 Score: 86.3 bits (212), Expect = 1.0e-17 Identity = 46/82 (56.10%), Postives = 55/82 (67.07%), Query Frame = 1
BLAST of Csa6G041150 vs. TAIR10
Match: AT5G17480.1 (AT5G17480.1 pollen calcium-binding protein 1) HSP 1 Score: 85.9 bits (211), Expect = 1.3e-17 Identity = 46/82 (56.10%), Postives = 55/82 (67.07%), Query Frame = 1
BLAST of Csa6G041150 vs. TAIR10
Match: AT1G24620.1 (AT1G24620.1 EF hand calcium-binding protein family) HSP 1 Score: 64.7 bits (156), Expect = 3.2e-11 Identity = 32/67 (47.76%), Postives = 42/67 (62.69%), Query Frame = 1
BLAST of Csa6G041150 vs. TAIR10
Match: AT5G37770.1 (AT5G37770.1 EF hand calcium-binding protein family) HSP 1 Score: 60.8 bits (146), Expect = 4.6e-10 Identity = 29/61 (47.54%), Postives = 40/61 (65.57%), Query Frame = 1
BLAST of Csa6G041150 vs. TAIR10
Match: AT1G73630.1 (AT1G73630.1 EF hand calcium-binding protein family) HSP 1 Score: 57.4 bits (137), Expect = 5.0e-09 Identity = 29/66 (43.94%), Postives = 42/66 (63.64%), Query Frame = 1
BLAST of Csa6G041150 vs. NCBI nr
Match: gi|700190775|gb|KGN45979.1| (hypothetical protein Csa_6G041150 [Cucumis sativus]) HSP 1 Score: 172.2 bits (435), Expect = 4.0e-40 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 1
BLAST of Csa6G041150 vs. NCBI nr
Match: gi|659089805|ref|XP_008445690.1| (PREDICTED: polcalcin Syr v 3-like [Cucumis melo]) HSP 1 Score: 160.6 bits (405), Expect = 1.2e-36 Identity = 79/84 (94.05%), Postives = 82/84 (97.62%), Query Frame = 1
BLAST of Csa6G041150 vs. NCBI nr
Match: gi|703085078|ref|XP_010092641.1| (Polcalcin Syr v 3 [Morus notabilis]) HSP 1 Score: 114.4 bits (285), Expect = 9.8e-23 Identity = 56/84 (66.67%), Postives = 69/84 (82.14%), Query Frame = 1
BLAST of Csa6G041150 vs. NCBI nr
Match: gi|595883136|ref|XP_007212731.1| (hypothetical protein PRUPE_ppa019115mg [Prunus persica]) HSP 1 Score: 114.0 bits (284), Expect = 1.3e-22 Identity = 59/84 (70.24%), Postives = 68/84 (80.95%), Query Frame = 1
BLAST of Csa6G041150 vs. NCBI nr
Match: gi|947093915|gb|KRH42500.1| (hypothetical protein GLYMA_08G093000 [Glycine max]) HSP 1 Score: 107.1 bits (266), Expect = 1.6e-20 Identity = 52/77 (67.53%), Postives = 61/77 (79.22%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|