Csa5G646690 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.GGAGGAGGAAGAGGAACAAAGAAATCAGAAATGCCACGAAATATGAACGGAAACAGAAACCAAGACGGAGAAGATGAGAGGGGATTATTGTGGAATCTTCCCGTTCTTAAATCTTCCAGATTCGGAAATTTAGGCCCCGCCTTCGGTCTCGGCGTTGGTTGTGGCGTCGGCTTTGGCATCGGCCTCGTCGGAGGTCAATTCTTCATCACCTTTTTTCTTTTACTCATAATTAACTTGTTATTTCAAGTTTTTTCGTATGGATTGTTTCACCCTGCAACTTGCTGATTGTTTTATTTGGAGGTTTTCTTGTTCAATTGGAGGGTTATTTAGTCTGAAATGTTTGTTTGGTTTAGGCTGATTATCGTTTTAATTTGTATTTGTGCCGTCTACTGTCTTTGACTGTTGTCCGTGTCTCCTGAATTTGGGTTGAGAGAATATGAGTGTTTGGCTGCTGAAATTCTGTAGCCCTGTGATATTTTCCCCAAGTTTACGGATAATTTGACTTTGTTTTGAAGAAGCTCAAAGATGGAGGAGACGCAATACGAGATCACGACATACGTATTTTTCGAGAATAACGTTATAAAGATGCTATGGGTAACACAAATGTGTTAGAGTTTAGACTTGAGAAAGGGAATGCTATTTTCTAGGATAGTTTGAAAATCATTCAAAGGAATAAAGTGTATCAATAAGAAAAATAACTAATTTTCCTACAAAATAGCTCAATTATGAATCCCCAAATGGCGCCCGGATGTAGTTCATTCAGGTGTTAGTGTATATCTTTAACATATATATTTTTTTAAATTGTATTTCATGCTTCATCTTTATCATTCAACAATTTCAGACATGCCTTTTGATGGATACACCTCGAGAGGAATTCTAATCTGTATTGTAGTTTGTGAAATTTATGGACTAAGTTTCTTCAAGCAGTTTAATCGGATGTTGTGTCATTTATTTGTGTATTTATGTTTGTTTGTATGATTGTGATCAAATATGAAAAGCTTTAATCATTTTCACAAGTTTATCATCCAGCACCTTTTCTCTTCGTCTTTTCATTTTTTTGTACTTGTAAATATATTATTCAGTTTTGTTAACTTTTATGGTGGTTTTTCTTTTAGTCCGGAGGGTGGGTGTTGAATTTTATTTATCACAATTTAGGAGTCTACAAGCGTTACTTGGTTGCATATTTGAAGTTCCATCTATCTGTTTAGAAGGATTTTCAGGTGCCAGAAGCTTGAAATGTATTAGGCTTAAAAAATTGGAGTTCACAAAGCACTCCATTGTTGATGAGGATTAAATTCTCTCAATCCTTTGTGATAGTATGGCTTTTAGTCTATAAGAAACGCCATTGATTTTCTTTTTCATAGTAGACACTAGACATTAACTGGATGAGAAAAAAGGAACAGTAGCAATTGGGATGATAAGGCATTCTTTGTTCTCCCACATGCACACTTAAATAAACACATAGAAGAAGAAGCTATTGTGGATTTTAGGTTTTGGTAGAAGGTAGGGCATGAGTGTCAGCCAATGAATAAATATTTTCATTGTTGAAATTTTATTTTGCACTTTATACTGTGGTGAACTACCCTTGTTTAGTTTAATTGAAACTAATTAAATAGATGAATTTGCTAAAAAATTTCTCCACTCTAGGTGCTGGATTTGGTCCAGGAATTCCTGGCTTACAGCTTGGCTTTGGTCTTGGTGCTGGATGTGGAGTTGGCTTAGGATTTGGCTATGGTGTTGGCAGGGGTATTGCCCAAGATGACAAACGCAGATACTCAAACGTTGGGGATGTATTGCGTGGTCGTCAAAGTATTTTTCCTCAGTAAGTTCTAAAACTAACTGTTTTCAACTTGTGACTACCATGTTCTCTTAGTTATGCATTATTACAAGTCAGGGAAAATTAACTTTTTCGTGGGTTTGGTGACCTGGCTTTTACATAACATGTACTTACTAAGGTGGCAATCCATGATAGATGATTCAAAATAGTTTTAATTGTACTATCAATCTCAAGGTTAGATTCCTTCCCCCCACATGTTGTAATAAGAAAAGTCCCATTCTTTATCTTCTTTCTCTCCTCTCTCTTCCCACTCTCTATCCCATTTCTCTCTTTTTGCTTAGTTTCTCTCTGCATTCTCTCTTCTTCCCAATTAATCTTATCAGTGGCTTGGACTCTATGTTGTGATTCACTTTCCATCTTTTCATTTCAACTCAGTTCATCTTCTTTCAATAACCTAGATCAATTGGGGTCAACTTAGACGTTCATCTTGAAAAATTGCCATTTTGTTTTTAAAATATCTATATCTTTTTAAAAGTTAGGAATATCACTCTTGACCTTTGAGAAATGTTTTTTTTGTCGCTCAAATTACTAACATCCTTCTCTTTCTTGTTCCCATTCGACTTAGGGAGACACTATCTTCTTATCCACCTCAGTTGGCTGGGTGAAATCATTGAAACTAACGGTTGATTGTCCAGATCGTTAAACTAAACTACCCTACGTTTTACCATCTTGGTTACATTTATAGGATGGTCAGAATAATAATTCCTTTTGAAATCATACTCTAATTTGCACAGGATTAAATAGTGCCTTTCTTAACAGTGAAAAGTTAGAAACTGATTGATGACATTTCCACGATTTTCATTTATAATCTGTGCAGCTATTGAACTTCAGTACTCTGACTTCATGAAACATTTCTTGACTTTCATTTTTACTTGTCATCCATCAGTCAGGACGATATCGGCGCGCTTGTTGACGACCTTGTCCTAAATACAAAGAGACTTATCCGAGCTACTTCAAAGGAGATTGACAAGTGGAAAAGATGAAATTTTACTCATTTGTTATTACATTGTACAAGTCTATTACGAACAACAACAATCAAAACTGAAGAACAAAGAAACGTGCTGGCTGACATATGGTATGTTATTACTTCGGCTTTTAGAGGCAGAATTTATGTACAATTGTTTAGAAAGATGTATTTAACCTCTAAATCTCATATGCATTGGGTTTTGAGCAATCTTAAAATGCCAAATGCTTAATGTATTAGTTTAGGTCCCTAGATGGCTGATTTATCATTGTGTGTATGCATTGGTTACGTGCGCCCGTAGTTAAAAGGTGAAATTTTGCTAATTCGGTCATTAGTCGTTCTTATACAAA ATGCCACGAAATATGAACGGAAACAGAAACCAAGACGGAGAAGATGAGAGGGGATTATTGTGGAATCTTCCCGTTCTTAAATCTTCCAGATTCGGAAATTTAGGCCCCGCCTTCGGTCTCGGCGTTGGTTGTGGCGTCGGCTTTGGCATCGGCCTCGTCGGAGGTGCTGGATTTGGTCCAGGAATTCCTGGCTTACAGCTTGGCTTTGGTCTTGGTGCTGGATGTGGAGTTGGCTTAGGATTTGGCTATGGTGTTGGCAGGGGTATTGCCCAAGATGACAAACGCAGATACTCAAACGTTGGGGATGTATTGCGTGGTCGTCAAAGTATTTTTCCTCATCAGGACGATATCGGCGCGCTTGTTGACGACCTTGTCCTAAATACAAAGAGACTTATCCGAGCTACTTCAAAGGAGATTGACAAGTGGAAAAGATGA ATGCCACGAAATATGAACGGAAACAGAAACCAAGACGGAGAAGATGAGAGGGGATTATTGTGGAATCTTCCCGTTCTTAAATCTTCCAGATTCGGAAATTTAGGCCCCGCCTTCGGTCTCGGCGTTGGTTGTGGCGTCGGCTTTGGCATCGGCCTCGTCGGAGGTGCTGGATTTGGTCCAGGAATTCCTGGCTTACAGCTTGGCTTTGGTCTTGGTGCTGGATGTGGAGTTGGCTTAGGATTTGGCTATGGTGTTGGCAGGGGTATTGCCCAAGATGACAAACGCAGATACTCAAACGTTGGGGATGTATTGCGTGGTCGTCAAAGTATTTTTCCTCATCAGGACGATATCGGCGCGCTTGTTGACGACCTTGTCCTAAATACAAAGAGACTTATCCGAGCTACTTCAAAGGAGATTGACAAGTGGAAAAGATGA MPRNMNGNRNQDGEDERGLLWNLPVLKSSRFGNLGPAFGLGVGCGVGFGIGLVGGAGFGPGIPGLQLGFGLGAGCGVGLGFGYGVGRGIAQDDKRRYSNVGDVLRGRQSIFPHQDDIGALVDDLVLNTKRLIRATSKEIDKWKR*
BLAST of Csa5G646690 vs. Swiss-Prot
Match: GRP1_PETHY (Glycine-rich cell wall structural protein 1 OS=Petunia hybrida GN=GRP-1 PE=1 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 5.2e-08 Identity = 41/82 (50.00%), Postives = 40/82 (48.78%), Query Frame = 1
HSP 2 Score: 50.4 bits (119), Expect = 1.9e-05 Identity = 29/58 (50.00%), Postives = 31/58 (53.45%), Query Frame = 1
HSP 3 Score: 47.4 bits (111), Expect = 1.6e-04 Identity = 28/54 (51.85%), Postives = 28/54 (51.85%), Query Frame = 1
HSP 4 Score: 45.8 bits (107), Expect = 4.6e-04 Identity = 29/63 (46.03%), Postives = 31/63 (49.21%), Query Frame = 1
HSP 5 Score: 43.1 bits (100), Expect = 3.0e-03 Identity = 28/57 (49.12%), Postives = 28/57 (49.12%), Query Frame = 1
BLAST of Csa5G646690 vs. Swiss-Prot
Match: FIBH_BOMMO (Fibroin heavy chain OS=Bombyx mori GN=FIBH PE=1 SV=4) HSP 1 Score: 53.5 bits (127), Expect = 2.2e-06 Identity = 28/54 (51.85%), Postives = 27/54 (50.00%), Query Frame = 1
HSP 2 Score: 52.0 bits (123), Expect = 6.4e-06 Identity = 27/54 (50.00%), Postives = 28/54 (51.85%), Query Frame = 1
HSP 3 Score: 51.2 bits (121), Expect = 1.1e-05 Identity = 27/54 (50.00%), Postives = 28/54 (51.85%), Query Frame = 1
HSP 4 Score: 50.8 bits (120), Expect = 1.4e-05 Identity = 28/55 (50.91%), Postives = 27/55 (49.09%), Query Frame = 1
HSP 5 Score: 50.8 bits (120), Expect = 1.4e-05 Identity = 28/55 (50.91%), Postives = 27/55 (49.09%), Query Frame = 1
HSP 6 Score: 50.8 bits (120), Expect = 1.4e-05 Identity = 28/55 (50.91%), Postives = 27/55 (49.09%), Query Frame = 1
HSP 7 Score: 50.8 bits (120), Expect = 1.4e-05 Identity = 28/55 (50.91%), Postives = 27/55 (49.09%), Query Frame = 1
HSP 8 Score: 50.4 bits (119), Expect = 1.9e-05 Identity = 27/54 (50.00%), Postives = 27/54 (50.00%), Query Frame = 1
HSP 9 Score: 50.4 bits (119), Expect = 1.9e-05 Identity = 27/54 (50.00%), Postives = 27/54 (50.00%), Query Frame = 1
HSP 10 Score: 50.4 bits (119), Expect = 1.9e-05 Identity = 27/54 (50.00%), Postives = 27/54 (50.00%), Query Frame = 1
HSP 11 Score: 50.4 bits (119), Expect = 1.9e-05 Identity = 28/55 (50.91%), Postives = 27/55 (49.09%), Query Frame = 1
HSP 12 Score: 50.4 bits (119), Expect = 1.9e-05 Identity = 28/54 (51.85%), Postives = 26/54 (48.15%), Query Frame = 1
HSP 13 Score: 50.4 bits (119), Expect = 1.9e-05 Identity = 28/54 (51.85%), Postives = 26/54 (48.15%), Query Frame = 1
HSP 14 Score: 50.1 bits (118), Expect = 2.4e-05 Identity = 25/54 (46.30%), Postives = 25/54 (46.30%), Query Frame = 1
HSP 15 Score: 49.7 bits (117), Expect = 3.2e-05 Identity = 28/54 (51.85%), Postives = 27/54 (50.00%), Query Frame = 1
HSP 16 Score: 49.3 bits (116), Expect = 4.1e-05 Identity = 26/54 (48.15%), Postives = 26/54 (48.15%), Query Frame = 1
HSP 17 Score: 48.9 bits (115), Expect = 5.4e-05 Identity = 25/55 (45.45%), Postives = 26/55 (47.27%), Query Frame = 1
BLAST of Csa5G646690 vs. TrEMBL
Match: F0YIS1_AURAN (Putative uncharacterized protein OS=Aureococcus anophagefferens GN=AURANDRAFT_72389 PE=4 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 3.7e-08 Identity = 34/71 (47.89%), Postives = 44/71 (61.97%), Query Frame = 1
BLAST of Csa5G646690 vs. TrEMBL
Match: F0YIS1_AURAN (Putative uncharacterized protein OS=Aureococcus anophagefferens GN=AURANDRAFT_72389 PE=4 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 3.1e-07 Identity = 37/79 (46.84%), Postives = 46/79 (58.23%), Query Frame = 1
HSP 2 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 3 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 4 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 5 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 6 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 7 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 8 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 9 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 10 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 11 Score: 59.3 bits (142), Expect = 4.5e-06 Identity = 39/91 (42.86%), Postives = 49/91 (53.85%), Query Frame = 1
HSP 12 Score: 58.5 bits (140), Expect = 7.6e-06 Identity = 40/103 (38.83%), Postives = 49/103 (47.57%), Query Frame = 1
HSP 13 Score: 65.9 bits (159), Expect = 4.8e-08 Identity = 31/57 (54.39%), Postives = 38/57 (66.67%), Query Frame = 1
BLAST of Csa5G646690 vs. TrEMBL
Match: A7J7D1_PBCVF (Putative uncharacterized protein n427L OS=Paramecium bursaria Chlorella virus FR483 GN=n427L PE=4 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.4e-07 Identity = 30/59 (50.85%), Postives = 40/59 (67.80%), Query Frame = 1
HSP 2 Score: 63.2 bits (152), Expect = 3.1e-07 Identity = 31/55 (56.36%), Postives = 35/55 (63.64%), Query Frame = 1
HSP 3 Score: 62.8 bits (151), Expect = 4.0e-07 Identity = 34/58 (58.62%), Postives = 40/58 (68.97%), Query Frame = 1
HSP 4 Score: 62.8 bits (151), Expect = 4.0e-07 Identity = 29/56 (51.79%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 5 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 29/56 (51.79%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 6 Score: 61.2 bits (147), Expect = 1.2e-06 Identity = 31/55 (56.36%), Postives = 37/55 (67.27%), Query Frame = 1
HSP 7 Score: 61.2 bits (147), Expect = 1.2e-06 Identity = 30/56 (53.57%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 8 Score: 60.8 bits (146), Expect = 1.5e-06 Identity = 30/56 (53.57%), Postives = 37/56 (66.07%), Query Frame = 1
HSP 9 Score: 60.5 bits (145), Expect = 2.0e-06 Identity = 29/56 (51.79%), Postives = 37/56 (66.07%), Query Frame = 1
HSP 10 Score: 59.7 bits (143), Expect = 3.4e-06 Identity = 29/56 (51.79%), Postives = 36/56 (64.29%), Query Frame = 1
HSP 11 Score: 65.9 bits (159), Expect = 4.8e-08 Identity = 31/59 (52.54%), Postives = 41/59 (69.49%), Query Frame = 1
BLAST of Csa5G646690 vs. TrEMBL
Match: M1HAX1_9PHYC (Uncharacterized protein OS=Paramecium bursaria Chlorella virus AP110A GN=AP110A_490L PE=4 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 1.2e-06 Identity = 33/55 (60.00%), Postives = 38/55 (69.09%), Query Frame = 1
HSP 2 Score: 60.5 bits (145), Expect = 2.0e-06 Identity = 29/56 (51.79%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 3 Score: 59.7 bits (143), Expect = 3.4e-06 Identity = 30/56 (53.57%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 4 Score: 59.7 bits (143), Expect = 3.4e-06 Identity = 30/65 (46.15%), Postives = 40/65 (61.54%), Query Frame = 1
HSP 5 Score: 33.1 bits (74), Expect = 3.4e+02 Identity = 14/26 (53.85%), Postives = 16/26 (61.54%), Query Frame = 1
HSP 6 Score: 65.5 bits (158), Expect = 6.2e-08 Identity = 33/63 (52.38%), Postives = 42/63 (66.67%), Query Frame = 1
BLAST of Csa5G646690 vs. TrEMBL
Match: A0A158PUT0_BRUMA (Uncharacterized protein OS=Brugia malayi PE=4 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 1.8e-07 Identity = 32/56 (57.14%), Postives = 39/56 (69.64%), Query Frame = 1
HSP 2 Score: 63.9 bits (154), Expect = 1.8e-07 Identity = 32/56 (57.14%), Postives = 39/56 (69.64%), Query Frame = 1
HSP 3 Score: 63.9 bits (154), Expect = 1.8e-07 Identity = 32/56 (57.14%), Postives = 39/56 (69.64%), Query Frame = 1
HSP 4 Score: 63.9 bits (154), Expect = 1.8e-07 Identity = 32/56 (57.14%), Postives = 39/56 (69.64%), Query Frame = 1
HSP 5 Score: 63.9 bits (154), Expect = 1.8e-07 Identity = 32/56 (57.14%), Postives = 39/56 (69.64%), Query Frame = 1
HSP 6 Score: 63.9 bits (154), Expect = 1.8e-07 Identity = 32/56 (57.14%), Postives = 39/56 (69.64%), Query Frame = 1
HSP 7 Score: 63.9 bits (154), Expect = 1.8e-07 Identity = 32/56 (57.14%), Postives = 39/56 (69.64%), Query Frame = 1
HSP 8 Score: 63.9 bits (154), Expect = 1.8e-07 Identity = 32/56 (57.14%), Postives = 39/56 (69.64%), Query Frame = 1
HSP 9 Score: 63.9 bits (154), Expect = 1.8e-07 Identity = 32/56 (57.14%), Postives = 39/56 (69.64%), Query Frame = 1
HSP 10 Score: 63.9 bits (154), Expect = 1.8e-07 Identity = 32/56 (57.14%), Postives = 39/56 (69.64%), Query Frame = 1
HSP 11 Score: 63.9 bits (154), Expect = 1.8e-07 Identity = 32/56 (57.14%), Postives = 39/56 (69.64%), Query Frame = 1
HSP 12 Score: 63.9 bits (154), Expect = 1.8e-07 Identity = 32/56 (57.14%), Postives = 39/56 (69.64%), Query Frame = 1
HSP 13 Score: 62.8 bits (151), Expect = 4.0e-07 Identity = 32/57 (56.14%), Postives = 39/57 (68.42%), Query Frame = 1
HSP 14 Score: 62.4 bits (150), Expect = 5.3e-07 Identity = 33/70 (47.14%), Postives = 42/70 (60.00%), Query Frame = 1
HSP 15 Score: 62.0 bits (149), Expect = 6.9e-07 Identity = 31/57 (54.39%), Postives = 39/57 (68.42%), Query Frame = 1
HSP 16 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 17 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 18 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 19 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 20 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 21 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 22 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 23 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 24 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 25 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 26 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 27 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 28 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 29 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 30 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 31 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 32 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 33 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 34 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 35 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 36 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 37 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 38 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 39 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 40 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 41 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 42 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 43 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 44 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 45 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 46 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 47 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 48 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 49 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 50 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 51 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 52 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 53 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 54 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 55 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 56 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 57 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 58 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 59 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 60 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 61 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 62 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 63 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 64 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 65 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 66 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 67 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 68 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 69 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 70 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 71 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 72 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 73 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 74 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 75 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 76 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 77 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 78 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 79 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 80 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 81 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 82 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 83 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 84 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 85 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 86 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 87 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 88 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 89 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 90 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 91 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 92 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 93 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 94 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 95 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 96 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 97 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 98 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 99 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 100 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 101 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 102 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 103 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 104 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 105 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 106 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 107 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 108 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 109 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 110 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 111 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 112 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 113 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 114 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 115 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 116 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 117 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 118 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 119 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 120 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 121 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 122 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 123 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 124 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 125 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 126 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 127 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 128 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 129 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 130 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 131 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 132 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 133 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 134 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 135 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 136 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 137 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 138 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 139 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 140 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 141 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 142 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 143 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 144 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 145 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 146 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 147 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 148 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 149 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 150 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 151 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 152 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 153 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 154 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 155 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 156 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 157 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 158 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 159 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 160 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 161 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 162 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 163 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 164 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 165 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 166 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 167 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 168 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 169 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 170 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 171 Score: 61.2 bits (147), Expect = 1.2e-06 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 172 Score: 61.2 bits (147), Expect = 1.2e-06 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 173 Score: 61.2 bits (147), Expect = 1.2e-06 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 174 Score: 61.2 bits (147), Expect = 1.2e-06 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 175 Score: 61.2 bits (147), Expect = 1.2e-06 Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
HSP 176 Score: 33.9 bits (76), Expect = 2.0e+02 Identity = 14/25 (56.00%), Postives = 18/25 (72.00%), Query Frame = 1
HSP 177 Score: 27.7 bits (60), Expect = 1.4e+04 Identity = 12/25 (48.00%), Postives = 16/25 (64.00%), Query Frame = 1
HSP 178 Score: 65.5 bits (158), Expect = 6.2e-08 Identity = 37/79 (46.84%), Postives = 49/79 (62.03%), Query Frame = 1
BLAST of Csa5G646690 vs. TAIR10
Match: AT4G10330.1 (AT4G10330.1 glycine-rich protein) HSP 1 Score: 174.9 bits (442), Expect = 3.7e-44 Identity = 77/135 (57.04%), Postives = 98/135 (72.59%), Query Frame = 1
BLAST of Csa5G646690 vs. TAIR10
Match: AT1G66820.1 (AT1G66820.1 glycine-rich protein) HSP 1 Score: 67.4 bits (163), Expect = 8.3e-12 Identity = 35/69 (50.72%), Postives = 40/69 (57.97%), Query Frame = 1
BLAST of Csa5G646690 vs. TAIR10
Match: AT3G15400.1 (AT3G15400.1 anther 20) HSP 1 Score: 55.1 bits (131), Expect = 4.3e-08 Identity = 31/64 (48.44%), Postives = 35/64 (54.69%), Query Frame = 1
BLAST of Csa5G646690 vs. TAIR10
Match: AT2G32690.1 (AT2G32690.1 glycine-rich protein 23) HSP 1 Score: 52.8 bits (125), Expect = 2.1e-07 Identity = 32/57 (56.14%), Postives = 32/57 (56.14%), Query Frame = 1
HSP 2 Score: 45.4 bits (106), Expect = 3.4e-05 Identity = 30/58 (51.72%), Postives = 31/58 (53.45%), Query Frame = 1
HSP 3 Score: 38.9 bits (89), Expect = 3.2e-03 Identity = 30/56 (53.57%), Postives = 29/56 (51.79%), Query Frame = 1
HSP 4 Score: 37.7 bits (86), Expect = 7.0e-03 Identity = 25/49 (51.02%), Postives = 26/49 (53.06%), Query Frame = 1
BLAST of Csa5G646690 vs. TAIR10
Match: AT3G20470.1 (AT3G20470.1 glycine-rich protein 5) HSP 1 Score: 49.7 bits (117), Expect = 1.8e-06 Identity = 31/60 (51.67%), Postives = 30/60 (50.00%), Query Frame = 1
HSP 2 Score: 45.1 bits (105), Expect = 4.4e-05 Identity = 30/57 (52.63%), Postives = 29/57 (50.88%), Query Frame = 1
HSP 3 Score: 29.3 bits (64), Expect = 2.5e+00 Identity = 18/38 (47.37%), Postives = 18/38 (47.37%), Query Frame = 1
BLAST of Csa5G646690 vs. NCBI nr
Match: gi|449447517|ref|XP_004141514.1| (PREDICTED: glycine-rich cell wall structural protein 1 [Cucumis sativus]) HSP 1 Score: 302.0 bits (772), Expect = 5.7e-79 Identity = 144/144 (100.00%), Postives = 144/144 (100.00%), Query Frame = 1
BLAST of Csa5G646690 vs. NCBI nr
Match: gi|659119131|ref|XP_008459493.1| (PREDICTED: glycine-rich cell wall structural protein 1 [Cucumis melo]) HSP 1 Score: 297.4 bits (760), Expect = 1.4e-77 Identity = 141/144 (97.92%), Postives = 143/144 (99.31%), Query Frame = 1
BLAST of Csa5G646690 vs. NCBI nr
Match: gi|702381809|ref|XP_010063733.1| (PREDICTED: glycine-rich cell wall structural protein 2 [Eucalyptus grandis]) HSP 1 Score: 213.4 bits (542), Expect = 2.7e-52 Identity = 102/147 (69.39%), Postives = 120/147 (81.63%), Query Frame = 1
BLAST of Csa5G646690 vs. NCBI nr
Match: gi|922353187|ref|XP_013452410.1| (transmembrane protein, putative [Medicago truncatula]) HSP 1 Score: 213.0 bits (541), Expect = 3.5e-52 Identity = 97/134 (72.39%), Postives = 117/134 (87.31%), Query Frame = 1
BLAST of Csa5G646690 vs. NCBI nr
Match: gi|920714564|gb|KOM54652.1| (hypothetical protein LR48_Vigan10g054400 [Vigna angularis]) HSP 1 Score: 210.7 bits (535), Expect = 1.7e-51 Identity = 94/133 (70.68%), Postives = 116/133 (87.22%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|