Csa5G308790 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTCACTTTTTTACCTGCTGAAATGGTATGTTTCATAATTTTGATGAATGACATTAGCTTTTGGGAATCTCCAGGTATAGAAACACTTCAAAAGCGGTACAAAGTTGATGCAGGCGGTCAGTGTGGTCAAATGTACGTTATCATATGCTGATCAATAGTTTTCCATTTCTAGTTCGGTATTACTAATATATGTGTGAAGCATCCAGATTTCTAGATGAGAAAAACTCTACCTCTCTTTACTCCCATTCCACCTTGGGTTACATTCTTTCTTTTGCCCAGTAGATGGAATCTATTTATGAAAAACGAGTGCATATTTGCAGTCTAAAATAATTCCTAACAAATTGCTGTAACAGATTTGTTCAAAAGTTAGCCCTCCAATTGTTCAACGGGGACAATCATCAAGCAGCTTTTCGCATCTTATCGGATTTTCGCAAAGGAAAGTTTGGTTGGACTGCTTTGGAGAGGCCTCCCAGGTAATGCTGTTGGATGATGGTTTGCTTGAAGGTCAGAATTTGAGCTTCTCGCTCTTACACTAGTTGTACAGATTCTAAAGGCCACTCTCAAACTGAGAAATGAAATTCACGATGCTTATATTGCTTTCGACTTGCGGACTTGTGGGAAGCTCAAAATTGGAGACCTTGATCATAAATGGTAA ATGTTCACTTTTTTACCTGCTGAAATGGTATGTTTCATAATTTTGATGAATGACATTAGCTTTTGGGAATCTCCAGGTATAGAAACACTTCAAAAGCGGTACAAAGTTGATGCAGGCGGTCAGTGTGGTCAAATATTTGTTCAAAAGTTAGCCCTCCAATTGTTCAACGGGGACAATCATCAAGCAGCTTTTCGCATCTTATCGGATTTTCGCAAAGGAAAGTTTGGTTGGACTGCTTTGGAGAGGCCTCCCAGGTCAGAATTTGAGCTTCTCGCTCTTACACTAGTTGTACAGATTCTAAAGGCCACTCTCAAACTGAGAAATGAAATTCACGATGCTTATATTGCTTTCGACTTGCGGACTTGTGGGAAGCTCAAAATTGGAGACCTTGATCATAAATGGTAA ATGTTCACTTTTTTACCTGCTGAAATGGTATGTTTCATAATTTTGATGAATGACATTAGCTTTTGGGAATCTCCAGGTATAGAAACACTTCAAAAGCGGTACAAAGTTGATGCAGGCGGTCAGTGTGGTCAAATATTTGTTCAAAAGTTAGCCCTCCAATTGTTCAACGGGGACAATCATCAAGCAGCTTTTCGCATCTTATCGGATTTTCGCAAAGGAAAGTTTGGTTGGACTGCTTTGGAGAGGCCTCCCAGGTCAGAATTTGAGCTTCTCGCTCTTACACTAGTTGTACAGATTCTAAAGGCCACTCTCAAACTGAGAAATGAAATTCACGATGCTTATATTGCTTTCGACTTGCGGACTTGTGGGAAGCTCAAAATTGGAGACCTTGATCATAAATGGTAA MFTFLPAEMVCFIILMNDISFWESPGIETLQKRYKVDAGGQCGQIFVQKLALQLFNGDNHQAAFRILSDFRKGKFGWTALERPPRSEFELLALTLVVQILKATLKLRNEIHDAYIAFDLRTCGKLKIGDLDHKW*
BLAST of Csa5G308790 vs. Swiss-Prot
Match: DGP3_ARATH (DAR GTPase 3, chloroplastic OS=Arabidopsis thaliana GN=DGP3 PE=2 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 3.2e-15 Identity = 37/59 (62.71%), Postives = 43/59 (72.88%), Query Frame = 1
BLAST of Csa5G308790 vs. TrEMBL
Match: A0A0A0KPR0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G308790 PE=4 SV=1) HSP 1 Score: 276.6 bits (706), Expect = 1.7e-71 Identity = 134/134 (100.00%), Postives = 134/134 (100.00%), Query Frame = 1
BLAST of Csa5G308790 vs. TrEMBL
Match: A0A059A972_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_K03362 PE=4 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 3.0e-20 Identity = 50/72 (69.44%), Postives = 57/72 (79.17%), Query Frame = 1
BLAST of Csa5G308790 vs. TrEMBL
Match: A0A059A7U8_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_K03362 PE=4 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 3.0e-20 Identity = 50/72 (69.44%), Postives = 57/72 (79.17%), Query Frame = 1
BLAST of Csa5G308790 vs. TrEMBL
Match: A0A059A828_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_K03362 PE=4 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 3.0e-20 Identity = 50/72 (69.44%), Postives = 57/72 (79.17%), Query Frame = 1
BLAST of Csa5G308790 vs. TrEMBL
Match: A0A061DQU2_THECC (GTP-binding family protein OS=Theobroma cacao GN=TCM_004383 PE=4 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 1.5e-19 Identity = 47/73 (64.38%), Postives = 60/73 (82.19%), Query Frame = 1
BLAST of Csa5G308790 vs. TAIR10
Match: AT4G02790.1 (AT4G02790.1 GTP-binding family protein) HSP 1 Score: 82.8 bits (203), Expect = 1.8e-16 Identity = 37/59 (62.71%), Postives = 43/59 (72.88%), Query Frame = 1
BLAST of Csa5G308790 vs. NCBI nr
Match: gi|700195697|gb|KGN50874.1| (hypothetical protein Csa_5G308790 [Cucumis sativus]) HSP 1 Score: 276.6 bits (706), Expect = 2.4e-71 Identity = 134/134 (100.00%), Postives = 134/134 (100.00%), Query Frame = 1
BLAST of Csa5G308790 vs. NCBI nr
Match: gi|778702006|ref|XP_011655122.1| (PREDICTED: mitochondrial ribosome-associated GTPase 1 [Cucumis sativus]) HSP 1 Score: 129.4 bits (324), Expect = 4.7e-27 Identity = 63/72 (87.50%), Postives = 66/72 (91.67%), Query Frame = 1
BLAST of Csa5G308790 vs. NCBI nr
Match: gi|659126309|ref|XP_008463116.1| (PREDICTED: mitochondrial ribosome-associated GTPase 1 [Cucumis melo]) HSP 1 Score: 125.9 bits (315), Expect = 5.2e-26 Identity = 61/72 (84.72%), Postives = 65/72 (90.28%), Query Frame = 1
BLAST of Csa5G308790 vs. NCBI nr
Match: gi|629083445|gb|KCW49890.1| (hypothetical protein EUGRSUZ_K03362 [Eucalyptus grandis]) HSP 1 Score: 106.3 bits (264), Expect = 4.3e-20 Identity = 50/72 (69.44%), Postives = 57/72 (79.17%), Query Frame = 1
BLAST of Csa5G308790 vs. NCBI nr
Match: gi|702499899|ref|XP_010038090.1| (PREDICTED: mitochondrial ribosome-associated GTPase 1 isoform X2 [Eucalyptus grandis]) HSP 1 Score: 106.3 bits (264), Expect = 4.3e-20 Identity = 50/72 (69.44%), Postives = 57/72 (79.17%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|