Csa4G620560 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAGGTATTCTCATCAATACATTTGAGGAGTTGGAATCACATGTGATATATTCTTTGTCTACTGACTCCTCTTTGCAACTTCCACCTTTGTATTCTGTTGGACCTGTTTTACACTTGAAAAAGAATATTGAGACTATGGATCGTGTAGATGTGTTGAAGTGGCTTGATGACCAACCTCCACCATCGGTTGTGTTTTTGTGCTTTGGAAGTCGAGGAAGCTTCGAGAAGGACCAAGTGGAGGAGATTGGACGAGCACTGTTTCATTTGGTCCCTCCGCCAACCGTTGGAACAAAATGGGATGAAAACAGCAATAGACTATACAAACTTTGAAGACATCTTACCCGAGGGGTTTCTCGACCGAACCAAAAATGTTGGTAGAGTCATCAGTTGGGCACCACAAGTGGAGATATTAGCCCATCCCGCCACAGGTAAGGGTTCAAATATCTGTCAATACATCCCAAAAT ATGAAAGGTATTCTCATCAATACATTTGAGGAGTTGGAATCACATGTGATATATTCTTTGTCTACTGACTCCTCTTTGCAACTTCCACCTTTGTATTCTGTTGGACCTGTTTTACACTTGAAAAAGAATATTGAGACTATGGATCGTGTAGATGTGTTGAAGTGGCTTGATGACCAACCTCCACCATCGGTTGTGTTTTTGTGCTTTGGAAGTCGAGGAAGCTTCGAGAAGGACCAAGTGGAGGAGATTGGACGAGCACTGTTTCATTTGGTCCCTCCGCCAACCGTTGGAACAAAATGGGATGAAAACAGCAATAGACTATACAAACTTTGA ATGAAAGGTATTCTCATCAATACATTTGAGGAGTTGGAATCACATGTGATATATTCTTTGTCTACTGACTCCTCTTTGCAACTTCCACCTTTGTATTCTGTTGGACCTGTTTTACACTTGAAAAAGAATATTGAGACTATGGATCGTGTAGATGTGTTGAAGTGGCTTGATGACCAACCTCCACCATCGGTTGTGTTTTTGTGCTTTGGAAGTCGAGGAAGCTTCGAGAAGGACCAAGTGGAGGAGATTGGACGAGCACTGTTTCATTTGGTCCCTCCGCCAACCGTTGGAACAAAATGGGATGAAAACAGCAATAGACTATACAAACTTTGA MKGILINTFEELESHVIYSLSTDSSLQLPPLYSVGPVLHLKKNIETMDRVDVLKWLDDQPPPSVVFLCFGSRGSFEKDQVEEIGRALFHLVPPPTVGTKWDENSNRLYKL*
BLAST of Csa4G620560 vs. Swiss-Prot
Match: UFOG3_FRAAN (Putative UDP-glucose flavonoid 3-O-glucosyltransferase 3 OS=Fragaria ananassa GN=GT3 PE=2 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 5.8e-23 Identity = 53/94 (56.38%), Postives = 68/94 (72.34%), Query Frame = 1
BLAST of Csa4G620560 vs. Swiss-Prot
Match: U7A16_PYRCO (UDP-glycosyltransferase 71A16 OS=Pyrus communis GN=UGT71A16 PE=1 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 7.0e-21 Identity = 56/106 (52.83%), Postives = 70/106 (66.04%), Query Frame = 1
BLAST of Csa4G620560 vs. Swiss-Prot
Match: U7A15_MALDO (UDP-glycosyltransferase 71A15 OS=Malus domestica GN=UGT71A15 PE=1 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 1.2e-20 Identity = 53/88 (60.23%), Postives = 64/88 (72.73%), Query Frame = 1
BLAST of Csa4G620560 vs. Swiss-Prot
Match: UFOG6_FRAAN (UDP-glucose flavonoid 3-O-glucosyltransferase 6 OS=Fragaria ananassa GN=GT6 PE=1 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 1.0e-19 Identity = 50/92 (54.35%), Postives = 63/92 (68.48%), Query Frame = 1
BLAST of Csa4G620560 vs. Swiss-Prot
Match: UFOG6_MANES (Anthocyanidin 3-O-glucosyltransferase 6 (Fragment) OS=Manihot esculenta GN=GT6 PE=2 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 1.3e-19 Identity = 48/88 (54.55%), Postives = 62/88 (70.45%), Query Frame = 1
BLAST of Csa4G620560 vs. TrEMBL
Match: A0A0A0KZX3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G620560 PE=4 SV=1) HSP 1 Score: 228.0 bits (580), Expect = 5.6e-57 Identity = 110/110 (100.00%), Postives = 110/110 (100.00%), Query Frame = 1
BLAST of Csa4G620560 vs. TrEMBL
Match: A0A0A0L341_CUCSA (Glycosyltransferase OS=Cucumis sativus GN=Csa_4G620550 PE=3 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 4.3e-33 Identity = 73/87 (83.91%), Postives = 78/87 (89.66%), Query Frame = 1
BLAST of Csa4G620560 vs. TrEMBL
Match: K7NBW4_SIRGR (Glycosyltransferase OS=Siraitia grosvenorii GN=UDPG7 PE=2 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 1.1e-23 Identity = 58/92 (63.04%), Postives = 71/92 (77.17%), Query Frame = 1
BLAST of Csa4G620560 vs. TrEMBL
Match: A0A0A0KZV7_CUCSA (Glycosyltransferase OS=Cucumis sativus GN=Csa_4G618530 PE=3 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 3.2e-20 Identity = 56/108 (51.85%), Postives = 76/108 (70.37%), Query Frame = 1
BLAST of Csa4G620560 vs. TrEMBL
Match: A0A0D2PP33_GOSRA (Glycosyltransferase OS=Gossypium raimondii GN=B456_005G073700 PE=3 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 3.2e-20 Identity = 52/86 (60.47%), Postives = 64/86 (74.42%), Query Frame = 1
BLAST of Csa4G620560 vs. TAIR10
Match: AT3G21790.1 (AT3G21790.1 UDP-Glycosyltransferase superfamily protein) HSP 1 Score: 90.5 bits (223), Expect = 7.0e-19 Identity = 46/90 (51.11%), Postives = 60/90 (66.67%), Query Frame = 1
BLAST of Csa4G620560 vs. TAIR10
Match: AT1G07250.1 (AT1G07250.1 UDP-glucosyl transferase 71C4) HSP 1 Score: 90.1 bits (222), Expect = 9.1e-19 Identity = 49/90 (54.44%), Postives = 58/90 (64.44%), Query Frame = 1
BLAST of Csa4G620560 vs. TAIR10
Match: AT4G15260.1 (AT4G15260.1 UDP-Glycosyltransferase superfamily protein) HSP 1 Score: 89.7 bits (221), Expect = 1.2e-18 Identity = 46/88 (52.27%), Postives = 58/88 (65.91%), Query Frame = 1
BLAST of Csa4G620560 vs. TAIR10
Match: AT3G21800.1 (AT3G21800.1 UDP-glucosyl transferase 71B8) HSP 1 Score: 87.8 bits (216), Expect = 4.5e-18 Identity = 47/90 (52.22%), Postives = 60/90 (66.67%), Query Frame = 1
BLAST of Csa4G620560 vs. TAIR10
Match: AT4G15280.1 (AT4G15280.1 UDP-glucosyl transferase 71B5) HSP 1 Score: 83.6 bits (205), Expect = 8.6e-17 Identity = 43/88 (48.86%), Postives = 55/88 (62.50%), Query Frame = 1
BLAST of Csa4G620560 vs. NCBI nr
Match: gi|700199835|gb|KGN54993.1| (hypothetical protein Csa_4G620560 [Cucumis sativus]) HSP 1 Score: 228.0 bits (580), Expect = 8.0e-57 Identity = 110/110 (100.00%), Postives = 110/110 (100.00%), Query Frame = 1
BLAST of Csa4G620560 vs. NCBI nr
Match: gi|778697790|ref|XP_011654405.1| (PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 3 [Cucumis sativus]) HSP 1 Score: 184.5 bits (467), Expect = 1.0e-43 Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 1
BLAST of Csa4G620560 vs. NCBI nr
Match: gi|449456659|ref|XP_004146066.1| (PREDICTED: anthocyanidin 3-O-glucosyltransferase 2 [Cucumis sativus]) HSP 1 Score: 148.7 bits (374), Expect = 6.1e-33 Identity = 73/87 (83.91%), Postives = 78/87 (89.66%), Query Frame = 1
BLAST of Csa4G620560 vs. NCBI nr
Match: gi|659129340|ref|XP_008464637.1| (PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Cucumis melo]) HSP 1 Score: 144.4 bits (363), Expect = 1.2e-31 Identity = 71/87 (81.61%), Postives = 77/87 (88.51%), Query Frame = 1
BLAST of Csa4G620560 vs. NCBI nr
Match: gi|343466221|gb|AEM43004.1| (UDP-glucosyltransferase [Siraitia grosvenorii]) HSP 1 Score: 117.5 bits (293), Expect = 1.5e-23 Identity = 58/92 (63.04%), Postives = 71/92 (77.17%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|