Csa2G258750 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.AACAAACAGCTGATCTCCAACCCAAATCTCTCACATATTCTCTTTTAAGTACAAGCACATTTTATCTCAATCAAATTCAGAGATGGGAATCCGTTTTCCTTCGGTCCTCCTCAGTGCCAAGCAGATTCTCAAGATGAAATCTGTTTCTATAAGATGTCAGTCTGATGTTCCCAAAGGCCACATTCCGGTGTATGTTGGAGAAAACCAGAGAAAGCGGTTTTTTGTTCCGATTTCTTACTTGAATCATCCTTCATTTGTGAATTTACTTAGTAGAGCTGAAGAAGAGTTTGGATTCAGCCATCCAACAGGAGGTTTGACCATTCCCTGCAAAGAAGAAGCCTTCATTGATGTCACTTCTAGATTGCATATTTCATGAAGGATTGAGACCATAGAGAATATTCTCTCAATTTTGTTTATAGAAGATAAAAGTGAATACCACTGTAAATGGAAACTTTGACACACATGAGTTGCAATGAAGTTAAATTCTTTGTCCACA ATGGGAATCCGTTTTCCTTCGGTCCTCCTCAGTGCCAAGCAGATTCTCAAGATGAAATCTGTTTCTATAAGATGTCAGTCTGATGTTCCCAAAGGCCACATTCCGGTGTATGTTGGAGAAAACCAGAGAAAGCGGTTTTTTGTTCCGATTTCTTACTTGAATCATCCTTCATTTGTGAATTTACTTAGTAGAGCTGAAGAAGAGTTTGGATTCAGCCATCCAACAGGAGGTTTGACCATTCCCTGCAAAGAAGAAGCCTTCATTGATGTCACTTCTAGATTGCATATTTCATGA ATGGGAATCCGTTTTCCTTCGGTCCTCCTCAGTGCCAAGCAGATTCTCAAGATGAAATCTGTTTCTATAAGATGTCAGTCTGATGTTCCCAAAGGCCACATTCCGGTGTATGTTGGAGAAAACCAGAGAAAGCGGTTTTTTGTTCCGATTTCTTACTTGAATCATCCTTCATTTGTGAATTTACTTAGTAGAGCTGAAGAAGAGTTTGGATTCAGCCATCCAACAGGAGGTTTGACCATTCCCTGCAAAGAAGAAGCCTTCATTGATGTCACTTCTAGATTGCATATTTCATGA MGIRFPSVLLSAKQILKMKSVSIRCQSDVPKGHIPVYVGENQRKRFFVPISYLNHPSFVNLLSRAEEEFGFSHPTGGLTIPCKEEAFIDVTSRLHIS*
BLAST of Csa2G258750 vs. Swiss-Prot
Match: SAU23_ARATH (Auxin-responsive protein SAUR23 OS=Arabidopsis thaliana GN=SAUR23 PE=2 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 7.8e-24 Identity = 54/87 (62.07%), Postives = 65/87 (74.71%), Query Frame = 1
BLAST of Csa2G258750 vs. Swiss-Prot
Match: SAU24_ARATH (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana GN=SAUR24 PE=2 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 3.9e-23 Identity = 56/90 (62.22%), Postives = 64/90 (71.11%), Query Frame = 1
BLAST of Csa2G258750 vs. Swiss-Prot
Match: SAU20_ARATH (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana GN=SAUR20 PE=2 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 5.1e-23 Identity = 56/89 (62.92%), Postives = 63/89 (70.79%), Query Frame = 1
BLAST of Csa2G258750 vs. Swiss-Prot
Match: SAU22_ARATH (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana GN=SAUR22 PE=2 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 5.1e-23 Identity = 52/86 (60.47%), Postives = 64/86 (74.42%), Query Frame = 1
BLAST of Csa2G258750 vs. Swiss-Prot
Match: SAU19_ARATH (Auxin-responsive protein SAUR19 OS=Arabidopsis thaliana GN=SAUR19 PE=2 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.1e-22 Identity = 55/90 (61.11%), Postives = 65/90 (72.22%), Query Frame = 1
BLAST of Csa2G258750 vs. TrEMBL
Match: A0A0A0LLF7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258750 PE=4 SV=1) HSP 1 Score: 198.4 bits (503), Expect = 4.2e-48 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 1
BLAST of Csa2G258750 vs. TrEMBL
Match: A0A0A0LM65_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258730 PE=4 SV=1) HSP 1 Score: 190.7 bits (483), Expect = 8.7e-46 Identity = 93/97 (95.88%), Postives = 94/97 (96.91%), Query Frame = 1
BLAST of Csa2G258750 vs. TrEMBL
Match: A0A0A0LIZ4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258710 PE=4 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 5.1e-38 Identity = 79/97 (81.44%), Postives = 86/97 (88.66%), Query Frame = 1
BLAST of Csa2G258750 vs. TrEMBL
Match: A0A0A0LJ92_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258690 PE=4 SV=1) HSP 1 Score: 162.2 bits (409), Expect = 3.3e-37 Identity = 79/97 (81.44%), Postives = 86/97 (88.66%), Query Frame = 1
BLAST of Csa2G258750 vs. TrEMBL
Match: A0A0A0LPH3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258670 PE=4 SV=1) HSP 1 Score: 159.1 bits (401), Expect = 2.8e-36 Identity = 72/97 (74.23%), Postives = 89/97 (91.75%), Query Frame = 1
BLAST of Csa2G258750 vs. TAIR10
Match: AT4G38840.1 (AT4G38840.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 117.1 bits (292), Expect = 6.2e-27 Identity = 59/99 (59.60%), Postives = 68/99 (68.69%), Query Frame = 1
BLAST of Csa2G258750 vs. TAIR10
Match: AT5G18060.1 (AT5G18060.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 110.9 bits (276), Expect = 4.4e-25 Identity = 54/87 (62.07%), Postives = 65/87 (74.71%), Query Frame = 1
BLAST of Csa2G258750 vs. TAIR10
Match: AT4G34810.1 (AT4G34810.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 110.2 bits (274), Expect = 7.5e-25 Identity = 58/104 (55.77%), Postives = 73/104 (70.19%), Query Frame = 1
BLAST of Csa2G258750 vs. TAIR10
Match: AT2G21210.1 (AT2G21210.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 109.4 bits (272), Expect = 1.3e-24 Identity = 57/98 (58.16%), Postives = 68/98 (69.39%), Query Frame = 1
BLAST of Csa2G258750 vs. TAIR10
Match: AT5G18080.1 (AT5G18080.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 108.6 bits (270), Expect = 2.2e-24 Identity = 56/90 (62.22%), Postives = 64/90 (71.11%), Query Frame = 1
BLAST of Csa2G258750 vs. NCBI nr
Match: gi|778669595|ref|XP_011649275.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 198.4 bits (503), Expect = 6.0e-48 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 1
BLAST of Csa2G258750 vs. NCBI nr
Match: gi|778669591|ref|XP_011649272.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 190.7 bits (483), Expect = 1.2e-45 Identity = 93/97 (95.88%), Postives = 94/97 (96.91%), Query Frame = 1
BLAST of Csa2G258750 vs. NCBI nr
Match: gi|659115594|ref|XP_008457634.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 188.7 bits (478), Expect = 4.7e-45 Identity = 92/97 (94.85%), Postives = 94/97 (96.91%), Query Frame = 1
BLAST of Csa2G258750 vs. NCBI nr
Match: gi|449458550|ref|XP_004147010.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 164.9 bits (416), Expect = 7.3e-38 Identity = 79/97 (81.44%), Postives = 86/97 (88.66%), Query Frame = 1
BLAST of Csa2G258750 vs. NCBI nr
Match: gi|659115590|ref|XP_008457631.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 162.5 bits (410), Expect = 3.6e-37 Identity = 78/97 (80.41%), Postives = 85/97 (87.63%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|