Csa2G258740 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.TACTTGCTTCTGTACCAATCTGAACAAAACTTCAAATCTTTCTTAGTCTTTCATCATAACACAAATGGGGGTTCCATTACTATGTTTGGTTCCTCATGCAAAGAAAATCTTGAAGATGCAGTCAAGTTTTACCAAAAACCAACTGGATGTTCCAAAAGGCCATGTGGCGGTTTACGTGGGAGAGATTCAAAGGAAACGGTTCGTGGTTCCGGTATCTTACTTAAACGATCCATCGTTCCAACAACTGCTCAGCCGTGCAGAGGAAGAGTTTGGCTTCCACCATCCCCATGGGGGTCTAACAATTCCTTGCAAAGAAGATGCCTTTGTTGATCTCACTTCTAGATTGAAAGTAGCTTGA ATGGGGGTTCCATTACTATGTTTGGTTCCTCATGCAAAGAAAATCTTGAAGATGCAGTCAAGTTTTACCAAAAACCAACTGGATGTTCCAAAAGGCCATGTGGCGGTTTACGTGGGAGAGATTCAAAGGAAACGGTTCGTGGTTCCGGTATCTTACTTAAACGATCCATCGTTCCAACAACTGCTCAGCCGTGCAGAGGAAGAGTTTGGCTTCCACCATCCCCATGGGGGTCTAACAATTCCTTGCAAAGAAGATGCCTTTGTTGATCTCACTTCTAGATTGAAAGTAGCTTGA ATGGGGGTTCCATTACTATGTTTGGTTCCTCATGCAAAGAAAATCTTGAAGATGCAGTCAAGTTTTACCAAAAACCAACTGGATGTTCCAAAAGGCCATGTGGCGGTTTACGTGGGAGAGATTCAAAGGAAACGGTTCGTGGTTCCGGTATCTTACTTAAACGATCCATCGTTCCAACAACTGCTCAGCCGTGCAGAGGAAGAGTTTGGCTTCCACCATCCCCATGGGGGTCTAACAATTCCTTGCAAAGAAGATGCCTTTGTTGATCTCACTTCTAGATTGAAAGTAGCTTGA MGVPLLCLVPHAKKILKMQSSFTKNQLDVPKGHVAVYVGEIQRKRFVVPVSYLNDPSFQQLLSRAEEEFGFHHPHGGLTIPCKEDAFVDLTSRLKVA*
BLAST of Csa2G258740 vs. Swiss-Prot
Match: SAU24_ARATH (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana GN=SAUR24 PE=2 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 5.1e-23 Identity = 55/84 (65.48%), Postives = 63/84 (75.00%), Query Frame = 1
BLAST of Csa2G258740 vs. Swiss-Prot
Match: SAU20_ARATH (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana GN=SAUR20 PE=2 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.1e-22 Identity = 53/84 (63.10%), Postives = 62/84 (73.81%), Query Frame = 1
BLAST of Csa2G258740 vs. Swiss-Prot
Match: SAU23_ARATH (Auxin-responsive protein SAUR23 OS=Arabidopsis thaliana GN=SAUR23 PE=2 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.5e-22 Identity = 52/83 (62.65%), Postives = 62/83 (74.70%), Query Frame = 1
BLAST of Csa2G258740 vs. Swiss-Prot
Match: SAU22_ARATH (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana GN=SAUR22 PE=2 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 1.9e-22 Identity = 51/84 (60.71%), Postives = 63/84 (75.00%), Query Frame = 1
BLAST of Csa2G258740 vs. Swiss-Prot
Match: SAU21_ARATH (Auxin-responsive protein SAUR21 OS=Arabidopsis thaliana GN=SAUR21 PE=2 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 3.3e-22 Identity = 51/84 (60.71%), Postives = 63/84 (75.00%), Query Frame = 1
BLAST of Csa2G258740 vs. TrEMBL
Match: A0A0A0LJ99_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258740 PE=4 SV=1) HSP 1 Score: 200.3 bits (508), Expect = 1.1e-48 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 1
BLAST of Csa2G258740 vs. TrEMBL
Match: A0A0A0LPI0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258720 PE=4 SV=1) HSP 1 Score: 182.2 bits (461), Expect = 3.1e-43 Identity = 88/97 (90.72%), Postives = 92/97 (94.85%), Query Frame = 1
BLAST of Csa2G258740 vs. TrEMBL
Match: A0A0A0LLF1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258700 PE=4 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 5.1e-38 Identity = 77/97 (79.38%), Postives = 87/97 (89.69%), Query Frame = 1
BLAST of Csa2G258740 vs. TrEMBL
Match: A0A0A0LIZ9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258760 PE=4 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 1.9e-37 Identity = 75/97 (77.32%), Postives = 87/97 (89.69%), Query Frame = 1
BLAST of Csa2G258740 vs. TrEMBL
Match: A0A0A0LJA3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258790 PE=4 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 1.9e-37 Identity = 79/97 (81.44%), Postives = 85/97 (87.63%), Query Frame = 1
BLAST of Csa2G258740 vs. TAIR10
Match: AT4G38840.1 (AT4G38840.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 112.8 bits (281), Expect = 1.2e-25 Identity = 56/97 (57.73%), Postives = 70/97 (72.16%), Query Frame = 1
BLAST of Csa2G258740 vs. TAIR10
Match: AT4G34810.1 (AT4G34810.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 110.5 bits (275), Expect = 5.8e-25 Identity = 58/105 (55.24%), Postives = 74/105 (70.48%), Query Frame = 1
BLAST of Csa2G258740 vs. TAIR10
Match: AT2G21210.1 (AT2G21210.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 108.2 bits (269), Expect = 2.9e-24 Identity = 53/98 (54.08%), Postives = 71/98 (72.45%), Query Frame = 1
BLAST of Csa2G258740 vs. TAIR10
Match: AT5G18080.1 (AT5G18080.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 108.2 bits (269), Expect = 2.9e-24 Identity = 55/84 (65.48%), Postives = 63/84 (75.00%), Query Frame = 1
BLAST of Csa2G258740 vs. TAIR10
Match: AT5G18020.1 (AT5G18020.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 107.1 bits (266), Expect = 6.4e-24 Identity = 53/84 (63.10%), Postives = 62/84 (73.81%), Query Frame = 1
BLAST of Csa2G258740 vs. NCBI nr
Match: gi|778669593|ref|XP_011649273.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 200.3 bits (508), Expect = 1.6e-48 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 1
BLAST of Csa2G258740 vs. NCBI nr
Match: gi|659115592|ref|XP_008457632.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 183.0 bits (463), Expect = 2.6e-43 Identity = 87/97 (89.69%), Postives = 94/97 (96.91%), Query Frame = 1
BLAST of Csa2G258740 vs. NCBI nr
Match: gi|700206757|gb|KGN61876.1| (hypothetical protein Csa_2G258720 [Cucumis sativus]) HSP 1 Score: 182.2 bits (461), Expect = 4.4e-43 Identity = 88/97 (90.72%), Postives = 92/97 (94.85%), Query Frame = 1
BLAST of Csa2G258740 vs. NCBI nr
Match: gi|659115596|ref|XP_008457635.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 172.2 bits (435), Expect = 4.6e-40 Identity = 82/97 (84.54%), Postives = 89/97 (91.75%), Query Frame = 1
BLAST of Csa2G258740 vs. NCBI nr
Match: gi|778674175|ref|XP_011650154.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 164.9 bits (416), Expect = 7.3e-38 Identity = 77/97 (79.38%), Postives = 87/97 (89.69%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|