Csa2G258620 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TTCACTTCAGGAAGATTTAAAGATGGGAATCCGTTTGCCTTCAATTCTTCTTCACACTAAACAAATTCTCAAAATACAGGGTGTTTCTACTAAAGTTAAATCTGATATTCCCAAAGGACATATTGCAGTCTATGTAGGGGAAATCCAAACAAAGAGATTTGTGGTTCCAATTTCATTCTTAAACCATCCTTCTTTTCTAAACCTACTGAAAAGGGCCGAGGAGGAGTTTGGATTCAACCATCCAATGGGTGGCCTGACAATTCCCTGCAGAGAAGAGACCTTCATTGATCTCACGTCTAGGTTGCATACATCATGAGAGAGATAAAAGATCAACCATCTCCACACAGTTTTGCCAATTTTGTTATTCTTTTTCAGTTTCTCCTAGTTGTAGTAGAATATCAATGCATATGTATAGGAAGTACATAAAAATGACTGTACAGGAAGAGTGGACACTGATCAGTAAAATGACTAGTTATTTCTAA ATGGGAATCCGTTTGCCTTCAATTCTTCTTCACACTAAACAAATTCTCAAAATACAGGGTGTTTCTACTAAAGTTAAATCTGATATTCCCAAAGGACATATTGCAGTCTATGTAGGGGAAATCCAAACAAAGAGATTTGTGGTTCCAATTTCATTCTTAAACCATCCTTCTTTTCTAAACCTACTGAAAAGGGCCGAGGAGGAGTTTGGATTCAACCATCCAATGGGTGGCCTGACAATTCCCTGCAGAGAAGAGACCTTCATTGATCTCACGTCTAGGTTGCATACATCATGA ATGGGAATCCGTTTGCCTTCAATTCTTCTTCACACTAAACAAATTCTCAAAATACAGGGTGTTTCTACTAAAGTTAAATCTGATATTCCCAAAGGACATATTGCAGTCTATGTAGGGGAAATCCAAACAAAGAGATTTGTGGTTCCAATTTCATTCTTAAACCATCCTTCTTTTCTAAACCTACTGAAAAGGGCCGAGGAGGAGTTTGGATTCAACCATCCAATGGGTGGCCTGACAATTCCCTGCAGAGAAGAGACCTTCATTGATCTCACGTCTAGGTTGCATACATCATGA MGIRLPSILLHTKQILKIQGVSTKVKSDIPKGHIAVYVGEIQTKRFVVPISFLNHPSFLNLLKRAEEEFGFNHPMGGLTIPCREETFIDLTSRLHTS*
BLAST of Csa2G258620 vs. Swiss-Prot
Match: SAU23_ARATH (Auxin-responsive protein SAUR23 OS=Arabidopsis thaliana GN=SAUR23 PE=2 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.1e-22 Identity = 51/79 (64.56%), Postives = 60/79 (75.95%), Query Frame = 1
BLAST of Csa2G258620 vs. Swiss-Prot
Match: SAU24_ARATH (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana GN=SAUR24 PE=2 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.5e-22 Identity = 51/78 (65.38%), Postives = 60/78 (76.92%), Query Frame = 1
BLAST of Csa2G258620 vs. Swiss-Prot
Match: SAU20_ARATH (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana GN=SAUR20 PE=2 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 1.9e-22 Identity = 51/77 (66.23%), Postives = 59/77 (76.62%), Query Frame = 1
BLAST of Csa2G258620 vs. Swiss-Prot
Match: SAU22_ARATH (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana GN=SAUR22 PE=2 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 1.9e-22 Identity = 50/78 (64.10%), Postives = 60/78 (76.92%), Query Frame = 1
BLAST of Csa2G258620 vs. Swiss-Prot
Match: SAU19_ARATH (Auxin-responsive protein SAUR19 OS=Arabidopsis thaliana GN=SAUR19 PE=2 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.3e-21 Identity = 50/78 (64.10%), Postives = 59/78 (75.64%), Query Frame = 1
BLAST of Csa2G258620 vs. TrEMBL
Match: A0A0A0LPG7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258620 PE=4 SV=1) HSP 1 Score: 197.2 bits (500), Expect = 9.3e-48 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 1
BLAST of Csa2G258620 vs. TrEMBL
Match: A0A0A0LIZ4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258710 PE=4 SV=1) HSP 1 Score: 159.8 bits (403), Expect = 1.6e-36 Identity = 75/97 (77.32%), Postives = 85/97 (87.63%), Query Frame = 1
BLAST of Csa2G258620 vs. TrEMBL
Match: A0A0A0LPH3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258670 PE=4 SV=1) HSP 1 Score: 159.8 bits (403), Expect = 1.6e-36 Identity = 73/97 (75.26%), Postives = 88/97 (90.72%), Query Frame = 1
BLAST of Csa2G258620 vs. TrEMBL
Match: A0A0A0LM65_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258730 PE=4 SV=1) HSP 1 Score: 157.5 bits (397), Expect = 8.1e-36 Identity = 74/97 (76.29%), Postives = 86/97 (88.66%), Query Frame = 1
BLAST of Csa2G258620 vs. TrEMBL
Match: A0A059AP79_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_I01363 PE=4 SV=1) HSP 1 Score: 154.5 bits (389), Expect = 6.9e-35 Identity = 72/96 (75.00%), Postives = 84/96 (87.50%), Query Frame = 1
BLAST of Csa2G258620 vs. TAIR10
Match: AT4G38840.1 (AT4G38840.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 120.6 bits (301), Expect = 5.6e-28 Identity = 58/99 (58.59%), Postives = 73/99 (73.74%), Query Frame = 1
BLAST of Csa2G258620 vs. TAIR10
Match: AT4G34810.1 (AT4G34810.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 118.6 bits (296), Expect = 2.1e-27 Identity = 63/104 (60.58%), Postives = 74/104 (71.15%), Query Frame = 1
BLAST of Csa2G258620 vs. TAIR10
Match: AT2G21210.1 (AT2G21210.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 117.1 bits (292), Expect = 6.2e-27 Identity = 59/98 (60.20%), Postives = 74/98 (75.51%), Query Frame = 1
BLAST of Csa2G258620 vs. TAIR10
Match: AT4G34800.1 (AT4G34800.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 111.7 bits (278), Expect = 2.6e-25 Identity = 60/92 (65.22%), Postives = 68/92 (73.91%), Query Frame = 1
BLAST of Csa2G258620 vs. TAIR10
Match: AT5G18060.1 (AT5G18060.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 107.1 bits (266), Expect = 6.4e-24 Identity = 51/79 (64.56%), Postives = 60/79 (75.95%), Query Frame = 1
BLAST of Csa2G258620 vs. NCBI nr
Match: gi|449458542|ref|XP_004147006.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 197.2 bits (500), Expect = 1.3e-47 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 1
BLAST of Csa2G258620 vs. NCBI nr
Match: gi|659115580|ref|XP_008457625.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 193.4 bits (490), Expect = 1.9e-46 Identity = 94/97 (96.91%), Postives = 96/97 (98.97%), Query Frame = 1
BLAST of Csa2G258620 vs. NCBI nr
Match: gi|778669580|ref|XP_011649270.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 159.8 bits (403), Expect = 2.4e-36 Identity = 73/97 (75.26%), Postives = 88/97 (90.72%), Query Frame = 1
BLAST of Csa2G258620 vs. NCBI nr
Match: gi|449458550|ref|XP_004147010.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 159.8 bits (403), Expect = 2.4e-36 Identity = 75/97 (77.32%), Postives = 85/97 (87.63%), Query Frame = 1
BLAST of Csa2G258620 vs. NCBI nr
Match: gi|778669614|ref|XP_011649278.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 158.3 bits (399), Expect = 6.8e-36 Identity = 74/97 (76.29%), Postives = 88/97 (90.72%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|