Csa2G034770 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAAGTGGAAGAAAAAGAAGAAAATTGCAAGAGGAAGAAGAAGAAGAAGAAGATGAAAAGATGGAGTTGTTCTATGCTTTGATTCAAAACACGAAGGCCATGAGAGACGGAATGAAATATTCAAAAGAATTAACAGAAGAAGAGAAATCAAAAGGGGTTTGGAATCCGAAGTTTCAACCAGAAGATTTCAATGAAGAAGATGGTTATAATTACAACAACAAATCCAACATCATTCCTCTTCAATTATCAGCTGCTTCATCTTCAACAACAAAACAATTCAATGAAAAGAAACAACAAGAAGAAGATAAACATTACAAGGTTGTAGAAGTAAAAAAGGGGCTTGACCTTAATCTCTCTCTTTGA ATGGAAAGTGGAAGAAAAAGAAGAAAATTGCAAGAGGAAGAAGAAGAAGAAGAAGATGAAAAGATGGAGTTGTTCTATGCTTTGATTCAAAACACGAAGGCCATGAGAGACGGAATGAAATATTCAAAAGAATTAACAGAAGAAGAGAAATCAAAAGGGGTTTGGAATCCGAAGTTTCAACCAGAAGATTTCAATGAAGAAGATGGTTATAATTACAACAACAAATCCAACATCATTCCTCTTCAATTATCAGCTGCTTCATCTTCAACAACAAAACAATTCAATGAAAAGAAACAACAAGAAGAAGATAAACATTACAAGGTTGTAGAAGTAAAAAAGGGGCTTGACCTTAATCTCTCTCTTTGA ATGGAAAGTGGAAGAAAAAGAAGAAAATTGCAAGAGGAAGAAGAAGAAGAAGAAGATGAAAAGATGGAGTTGTTCTATGCTTTGATTCAAAACACGAAGGCCATGAGAGACGGAATGAAATATTCAAAAGAATTAACAGAAGAAGAGAAATCAAAAGGGGTTTGGAATCCGAAGTTTCAACCAGAAGATTTCAATGAAGAAGATGGTTATAATTACAACAACAAATCCAACATCATTCCTCTTCAATTATCAGCTGCTTCATCTTCAACAACAAAACAATTCAATGAAAAGAAACAACAAGAAGAAGATAAACATTACAAGGTTGTAGAAGTAAAAAAGGGGCTTGACCTTAATCTCTCTCTTTGA MESGRKRRKLQEEEEEEEDEKMELFYALIQNTKAMRDGMKYSKELTEEEKSKGVWNPKFQPEDFNEEDGYNYNNKSNIIPLQLSAASSSTTKQFNEKKQQEEDKHYKVVEVKKGLDLNLSL*
BLAST of Csa2G034770 vs. Swiss-Prot
Match: NIMI3_ARATH (Protein NIM1-INTERACTING 3 OS=Arabidopsis thaliana GN=NIMIN-3 PE=1 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 5.2e-09 Identity = 41/123 (33.33%), Postives = 65/123 (52.85%), Query Frame = 1
BLAST of Csa2G034770 vs. TrEMBL
Match: A0A0A0LJ23_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G034770 PE=4 SV=1) HSP 1 Score: 245.0 bits (624), Expect = 4.8e-62 Identity = 121/121 (100.00%), Postives = 121/121 (100.00%), Query Frame = 1
BLAST of Csa2G034770 vs. TrEMBL
Match: V4SLD2_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10013538mg PE=4 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 3.2e-13 Identity = 52/131 (39.69%), Postives = 69/131 (52.67%), Query Frame = 1
BLAST of Csa2G034770 vs. TrEMBL
Match: A0A061F4Z3_THECC (Uncharacterized protein OS=Theobroma cacao GN=TCM_026807 PE=4 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 2.7e-12 Identity = 54/143 (37.76%), Postives = 80/143 (55.94%), Query Frame = 1
BLAST of Csa2G034770 vs. TrEMBL
Match: A0A0L9TYF7_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan02g158700 PE=4 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 3.0e-11 Identity = 51/130 (39.23%), Postives = 69/130 (53.08%), Query Frame = 1
BLAST of Csa2G034770 vs. TrEMBL
Match: A0A0S3SQP4_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.08G181900 PE=4 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 3.0e-11 Identity = 51/130 (39.23%), Postives = 69/130 (53.08%), Query Frame = 1
BLAST of Csa2G034770 vs. TAIR10
Match: AT1G09415.1 (AT1G09415.1 NIM1-interacting 3) HSP 1 Score: 62.0 bits (149), Expect = 2.9e-10 Identity = 41/123 (33.33%), Postives = 65/123 (52.85%), Query Frame = 1
BLAST of Csa2G034770 vs. TAIR10
Match: AT1G02450.1 (AT1G02450.1 NIM1-interacting 1) HSP 1 Score: 50.8 bits (120), Expect = 6.8e-07 Identity = 41/130 (31.54%), Postives = 68/130 (52.31%), Query Frame = 1
BLAST of Csa2G034770 vs. NCBI nr
Match: gi|700205905|gb|KGN61024.1| (hypothetical protein Csa_2G034770 [Cucumis sativus]) HSP 1 Score: 245.0 bits (624), Expect = 6.9e-62 Identity = 121/121 (100.00%), Postives = 121/121 (100.00%), Query Frame = 1
BLAST of Csa2G034770 vs. NCBI nr
Match: gi|985452232|ref|XP_015386592.1| (PREDICTED: protein NIM1-INTERACTING 3 [Citrus sinensis]) HSP 1 Score: 82.8 bits (203), Expect = 4.6e-13 Identity = 52/131 (39.69%), Postives = 69/131 (52.67%), Query Frame = 1
BLAST of Csa2G034770 vs. NCBI nr
Match: gi|567871295|ref|XP_006428237.1| (hypothetical protein CICLE_v10013538mg [Citrus clementina]) HSP 1 Score: 82.8 bits (203), Expect = 4.6e-13 Identity = 52/131 (39.69%), Postives = 69/131 (52.67%), Query Frame = 1
BLAST of Csa2G034770 vs. NCBI nr
Match: gi|590644944|ref|XP_007031220.1| (Uncharacterized protein TCM_026807 [Theobroma cacao]) HSP 1 Score: 79.7 bits (195), Expect = 3.9e-12 Identity = 54/143 (37.76%), Postives = 80/143 (55.94%), Query Frame = 1
BLAST of Csa2G034770 vs. NCBI nr
Match: gi|657999954|ref|XP_008392413.1| (PREDICTED: protein NIM1-INTERACTING 1 [Malus domestica]) HSP 1 Score: 78.6 bits (192), Expect = 8.6e-12 Identity = 55/129 (42.64%), Postives = 75/129 (58.14%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|