Csa1G690340 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTAGATGATGATGGACTTGCTGCACTAGGAGAGATAATTGGACCAAGTGACGTTTATGTCAACAAACAATCCCCCATCATAATGAAAGGATCACCCTTACCAGGAATACCAGATAGTGCATATAGACCTTGTAGACAAGTATTTAAAGGTTCTGAAGGAGAGCCGACAGTGGTTGATGGGATGGCTCTTTCTACAGATAAGAATGACTGTTTATGTATCAAATTCTTCATTTGCCTGACCTGTAGACTAGAGCGGTGATAAGTTCAGTAGCAGACATATACAAAAAGGTGTATGTGGCACAATTGTGCAGCAAGAAGATTTCCCATTTTCTGCATGTGGAATTTCTGGATCTAATTATGAATCCTCATGGATTTCCGAGAAGTCATGA ATGTTAGATGATGATGGACTTGCTGCACTAGGAGAGATAATTGGACCAAGTGACGTTTATGTCAACAAACAATCCCCCATCATAATGAAAGGATCACCCTTACCAGGAATACCAGATAGTGCATATAGACCTTGTAGACAAGTATTTAAAGGTTCTGAAGGAGAGCCGACAGTGCAAGAAGATTTCCCATTTTCTGCATGTGGAATTTCTGGATCTAATTATGAATCCTCATGGATTTCCGAGAAGTCATGA ATGTTAGATGATGATGGACTTGCTGCACTAGGAGAGATAATTGGACCAAGTGACGTTTATGTCAACAAACAATCCCCCATCATAATGAAAGGATCACCCTTACCAGGAATACCAGATAGTGCATATAGACCTTGTAGACAAGTATTTAAAGGTTCTGAAGGAGAGCCGACAGTGCAAGAAGATTTCCCATTTTCTGCATGTGGAATTTCTGGATCTAATTATGAATCCTCATGGATTTCCGAGAAGTCATGA MLDDDGLAALGEIIGPSDVYVNKQSPIIMKGSPLPGIPDSAYRPCRQVFKGSEGEPTVQEDFPFSACGISGSNYESSWISEKS*
BLAST of Csa1G690340 vs. Swiss-Prot
Match: NRPC2_ARATH (DNA-directed RNA polymerase III subunit 2 OS=Arabidopsis thaliana GN=NRPC2 PE=2 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 4.2e-10 Identity = 31/58 (53.45%), Postives = 36/58 (62.07%), Query Frame = 1
BLAST of Csa1G690340 vs. TrEMBL
Match: A0A0A0M0Z5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G690340 PE=4 SV=1) HSP 1 Score: 174.1 bits (440), Expect = 7.2e-41 Identity = 83/83 (100.00%), Postives = 83/83 (100.00%), Query Frame = 1
BLAST of Csa1G690340 vs. TrEMBL
Match: F6HVA6_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_13s0084g00180 PE=4 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 4.9e-13 Identity = 41/61 (67.21%), Postives = 50/61 (81.97%), Query Frame = 1
BLAST of Csa1G690340 vs. TrEMBL
Match: A5AMN9_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_031440 PE=4 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 4.9e-13 Identity = 41/61 (67.21%), Postives = 50/61 (81.97%), Query Frame = 1
BLAST of Csa1G690340 vs. TrEMBL
Match: A0A059DCX6_EUCGR (DNA-directed RNA polymerase subunit beta (Fragment) OS=Eucalyptus grandis GN=EUGRSUZ_A007941 PE=3 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.8e-12 Identity = 43/78 (55.13%), Postives = 54/78 (69.23%), Query Frame = 1
BLAST of Csa1G690340 vs. TrEMBL
Match: W9RD68_9ROSA (DNA-directed RNA polymerase III subunit RPC2 OS=Morus notabilis GN=L484_011540 PE=4 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 1.0e-10 Identity = 35/58 (60.34%), Postives = 42/58 (72.41%), Query Frame = 1
BLAST of Csa1G690340 vs. TAIR10
Match: AT5G45140.1 (AT5G45140.1 nuclear RNA polymerase C2) HSP 1 Score: 65.1 bits (157), Expect = 2.4e-11 Identity = 31/58 (53.45%), Postives = 36/58 (62.07%), Query Frame = 1
BLAST of Csa1G690340 vs. NCBI nr
Match: gi|700211701|gb|KGN66797.1| (hypothetical protein Csa_1G690340 [Cucumis sativus]) HSP 1 Score: 174.1 bits (440), Expect = 1.0e-40 Identity = 83/83 (100.00%), Postives = 83/83 (100.00%), Query Frame = 1
BLAST of Csa1G690340 vs. NCBI nr
Match: gi|659124980|ref|XP_008462447.1| (PREDICTED: DNA-directed RNA polymerase III subunit RPC2 [Cucumis melo]) HSP 1 Score: 110.9 bits (276), Expect = 1.1e-21 Identity = 52/58 (89.66%), Postives = 55/58 (94.83%), Query Frame = 1
BLAST of Csa1G690340 vs. NCBI nr
Match: gi|778730035|ref|XP_004141655.2| (PREDICTED: DNA-directed RNA polymerase III subunit RPC2 [Cucumis sativus]) HSP 1 Score: 109.4 bits (272), Expect = 3.1e-21 Identity = 50/58 (86.21%), Postives = 55/58 (94.83%), Query Frame = 1
BLAST of Csa1G690340 vs. NCBI nr
Match: gi|147819201|emb|CAN62632.1| (hypothetical protein VITISV_031440 [Vitis vinifera]) HSP 1 Score: 81.6 bits (200), Expect = 7.0e-13 Identity = 41/61 (67.21%), Postives = 50/61 (81.97%), Query Frame = 1
BLAST of Csa1G690340 vs. NCBI nr
Match: gi|296087814|emb|CBI35070.3| (unnamed protein product [Vitis vinifera]) HSP 1 Score: 81.6 bits (200), Expect = 7.0e-13 Identity = 41/61 (67.21%), Postives = 50/61 (81.97%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|