Csa1G629190 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTACAACAAACTTCATAGTGATGCGTTGAGAGAAGCCATTTCATCTATATTTGCTGATAGCGGTGAAAAGAAGCGCAAATTCACCGAGACCATTGAACTTCATATTGGACTGAAGAACTATGATCCACAAAAGGACAAGCGTTTCAGTGGTTCAGTGAAGTTGCCGCATATCCCTCGCCCTAAGATGAAGATCTGCATTCTTGGAGATGTTTCACATGTTGAAGAGGTAACTTAA ATGTACAACAAACTTCATAGTGATGCGTTGAGAGAAGCCATTTCATCTATATTTGCTGATAGCGGTGAAAAGAAGCGCAAATTCACCGAGACCATTGAACTTCATATTGGACTGAAGAACTATGATCCACAAAAGGACAAGCGTTTCAGTGGTTCAGTGAAGTTGCCGCATATCCCTCGCCCTAAGATGAAGATCTGCATTCTTGGAGATGTTTCACATGTTGAAGAGGTAACTTAA ATGTACAACAAACTTCATAGTGATGCGTTGAGAGAAGCCATTTCATCTATATTTGCTGATAGCGGTGAAAAGAAGCGCAAATTCACCGAGACCATTGAACTTCATATTGGACTGAAGAACTATGATCCACAAAAGGACAAGCGTTTCAGTGGTTCAGTGAAGTTGCCGCATATCCCTCGCCCTAAGATGAAGATCTGCATTCTTGGAGATGTTTCACATGTTGAAGAGGTAACTTAA MYNKLHSDALREAISSIFADSGEKKRKFTETIELHIGLKNYDPQKDKRFSGSVKLPHIPRPKMKICILGDVSHVEEVT*
BLAST of Csa1G629190 vs. Swiss-Prot
Match: R10A_ORYSI (60S ribosomal protein L10a OS=Oryza sativa subsp. indica GN=RPL10A PE=3 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 3.6e-27 Identity = 56/74 (75.68%), Postives = 62/74 (83.78%), Query Frame = 1
BLAST of Csa1G629190 vs. Swiss-Prot
Match: R10A_ORYSJ (60S ribosomal protein L10a OS=Oryza sativa subsp. japonica GN=RPL10A PE=1 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 3.6e-27 Identity = 56/74 (75.68%), Postives = 62/74 (83.78%), Query Frame = 1
BLAST of Csa1G629190 vs. Swiss-Prot
Match: R10A2_ARATH (60S ribosomal protein L10a-2 OS=Arabidopsis thaliana GN=RPL10AB PE=1 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.0e-26 Identity = 57/74 (77.03%), Postives = 62/74 (83.78%), Query Frame = 1
BLAST of Csa1G629190 vs. Swiss-Prot
Match: R10A1_ARATH (60S ribosomal protein L10a-1 OS=Arabidopsis thaliana GN=RPL10AA PE=1 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 3.0e-26 Identity = 57/74 (77.03%), Postives = 61/74 (82.43%), Query Frame = 1
BLAST of Csa1G629190 vs. Swiss-Prot
Match: R10A3_ARATH (60S ribosomal protein L10a-3 OS=Arabidopsis thaliana GN=RPL10AC PE=1 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 1.2e-25 Identity = 58/75 (77.33%), Postives = 61/75 (81.33%), Query Frame = 1
BLAST of Csa1G629190 vs. TrEMBL
Match: A0A0A0M0B3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G629190 PE=4 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 7.7e-37 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 1
BLAST of Csa1G629190 vs. TrEMBL
Match: A0A0A0KEW8_CUCSA (Ribosomal protein OS=Cucumis sativus GN=Csa_6G152330 PE=3 SV=1) HSP 1 Score: 141.7 bits (356), Expect = 3.7e-31 Identity = 69/74 (93.24%), Postives = 71/74 (95.95%), Query Frame = 1
BLAST of Csa1G629190 vs. TrEMBL
Match: A0A0A0LVE6_CUCSA (Ribosomal protein OS=Cucumis sativus GN=Csa_1G163140 PE=3 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 7.0e-30 Identity = 66/74 (89.19%), Postives = 69/74 (93.24%), Query Frame = 1
BLAST of Csa1G629190 vs. TrEMBL
Match: A0A059DAY2_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_B03850 PE=4 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 1.7e-28 Identity = 63/74 (85.14%), Postives = 67/74 (90.54%), Query Frame = 1
BLAST of Csa1G629190 vs. TrEMBL
Match: A0A059D9G4_EUCGR (Ribosomal protein OS=Eucalyptus grandis GN=EUGRSUZ_B03850 PE=3 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 1.7e-28 Identity = 63/74 (85.14%), Postives = 67/74 (90.54%), Query Frame = 1
BLAST of Csa1G629190 vs. TAIR10
Match: AT2G27530.1 (AT2G27530.1 Ribosomal protein L1p/L10e family) HSP 1 Score: 120.2 bits (300), Expect = 5.9e-28 Identity = 57/74 (77.03%), Postives = 62/74 (83.78%), Query Frame = 1
BLAST of Csa1G629190 vs. TAIR10
Match: AT1G08360.1 (AT1G08360.1 Ribosomal protein L1p/L10e family) HSP 1 Score: 118.6 bits (296), Expect = 1.7e-27 Identity = 57/74 (77.03%), Postives = 61/74 (82.43%), Query Frame = 1
BLAST of Csa1G629190 vs. TAIR10
Match: AT5G22440.1 (AT5G22440.1 Ribosomal protein L1p/L10e family) HSP 1 Score: 116.7 bits (291), Expect = 6.5e-27 Identity = 58/75 (77.33%), Postives = 61/75 (81.33%), Query Frame = 1
BLAST of Csa1G629190 vs. NCBI nr
Match: gi|700211466|gb|KGN66562.1| (hypothetical protein Csa_1G629190 [Cucumis sativus]) HSP 1 Score: 160.6 bits (405), Expect = 1.1e-36 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 1
BLAST of Csa1G629190 vs. NCBI nr
Match: gi|659117410|ref|XP_008458587.1| (PREDICTED: 60S ribosomal protein L10a-1-like [Cucumis melo]) HSP 1 Score: 141.7 bits (356), Expect = 5.3e-31 Identity = 69/74 (93.24%), Postives = 71/74 (95.95%), Query Frame = 1
BLAST of Csa1G629190 vs. NCBI nr
Match: gi|659071695|ref|XP_008461453.1| (PREDICTED: 60S ribosomal protein L10a-1 [Cucumis melo]) HSP 1 Score: 137.5 bits (345), Expect = 1.0e-29 Identity = 66/74 (89.19%), Postives = 69/74 (93.24%), Query Frame = 1
BLAST of Csa1G629190 vs. NCBI nr
Match: gi|449443440|ref|XP_004139485.1| (PREDICTED: 60S ribosomal protein L10a-1 [Cucumis sativus]) HSP 1 Score: 137.5 bits (345), Expect = 1.0e-29 Identity = 66/74 (89.19%), Postives = 69/74 (93.24%), Query Frame = 1
BLAST of Csa1G629190 vs. NCBI nr
Match: gi|629122880|gb|KCW87370.1| (hypothetical protein EUGRSUZ_B03850 [Eucalyptus grandis]) HSP 1 Score: 132.9 bits (333), Expect = 2.5e-28 Identity = 63/74 (85.14%), Postives = 67/74 (90.54%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|