Csa1G313810 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCCACAACAGAGAAGCAATTGAAAGAGATGAGAATCGAGTACGTAAAGTGTGAGGTGGAAGACGAGGGGATCTTCGTTGACCAGCTCTTCTTCCACGACCCCGATGGCCTAATGATCGAAATTTGCAACTGTGAGAACCTCCCCATCTTACCGGTGTCAGGAGGTGGTGACTCCCCTACCACGGCCACCAACGCAGCTCGTTTCTGCAGTATTCAACAAGCAGAGGAACAACAAAAGCTAAAACAAATTCAAAGCGCCACCGTTCAAAGGATGCAACTCCAGCAACTTCTCATCAACATCCCATGCAACGCCTGGACATGAAAACTAAACTATATATATTGTCTTCCTTTATTATTTTGTATGTTGTTTTACATGTTCATCAAATCATTATCATCCTGGTTACGTTTATTTAAAATGATAAAAGGGAAAATTATGAATTTGATTGCAATCAAC ATGTCCACAACAGAGAAGCAATTGAAAGAGATGAGAATCGAGTACGTAAAGTGTGAGGTGGAAGACGAGGGGATCTTCGTTGACCAGCTCTTCTTCCACGACCCCGATGGCCTAATGATCGAAATTTGCAACTGTGAGAACCTCCCCATCTTACCGGTGTCAGGAGGTGGTGACTCCCCTACCACGGCCACCAACGCAGCTCGTTTCTGCAGTATTCAACAAGCAGAGGAACAACAAAAGCTAAAACAAATTCAAAGCGCCACCGTTCAAAGGATGCAACTCCAGCAACTTCTCATCAACATCCCATGCAACGCCTGGACATGA ATGTCCACAACAGAGAAGCAATTGAAAGAGATGAGAATCGAGTACGTAAAGTGTGAGGTGGAAGACGAGGGGATCTTCGTTGACCAGCTCTTCTTCCACGACCCCGATGGCCTAATGATCGAAATTTGCAACTGTGAGAACCTCCCCATCTTACCGGTGTCAGGAGGTGGTGACTCCCCTACCACGGCCACCAACGCAGCTCGTTTCTGCAGTATTCAACAAGCAGAGGAACAACAAAAGCTAAAACAAATTCAAAGCGCCACCGTTCAAAGGATGCAACTCCAGCAACTTCTCATCAACATCCCATGCAACGCCTGGACATGA MSTTEKQLKEMRIEYVKCEVEDEGIFVDQLFFHDPDGLMIEICNCENLPILPVSGGGDSPTTATNAARFCSIQQAEEQQKLKQIQSATVQRMQLQQLLINIPCNAWT*
BLAST of Csa1G313810 vs. TrEMBL
Match: A0A0A0LZB1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G313810 PE=4 SV=1) HSP 1 Score: 220.7 bits (561), Expect = 8.6e-55 Identity = 107/107 (100.00%), Postives = 107/107 (100.00%), Query Frame = 1
BLAST of Csa1G313810 vs. TrEMBL
Match: A5BHH5_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_11s0016g05010 PE=4 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 3.4e-19 Identity = 54/104 (51.92%), Postives = 74/104 (71.15%), Query Frame = 1
BLAST of Csa1G313810 vs. TrEMBL
Match: A0A165WYA1_DAUCA (Uncharacterized protein OS=Daucus carota subsp. sativus GN=DCAR_014871 PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 2.5e-17 Identity = 44/80 (55.00%), Postives = 57/80 (71.25%), Query Frame = 1
BLAST of Csa1G313810 vs. TrEMBL
Match: A0A0K9R6K6_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_101080 PE=4 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 1.2e-16 Identity = 45/91 (49.45%), Postives = 60/91 (65.93%), Query Frame = 1
BLAST of Csa1G313810 vs. TrEMBL
Match: A0A151SH42_CAJCA (Metallothiol transferase fosB OS=Cajanus cajan GN=KK1_000197 PE=4 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 1.6e-16 Identity = 46/90 (51.11%), Postives = 59/90 (65.56%), Query Frame = 1
BLAST of Csa1G313810 vs. TAIR10
Match: AT1G80160.1 (AT1G80160.1 Lactoylglutathione lyase / glyoxalase I family protein) HSP 1 Score: 83.6 bits (205), Expect = 8.3e-17 Identity = 36/55 (65.45%), Postives = 43/55 (78.18%), Query Frame = 1
BLAST of Csa1G313810 vs. TAIR10
Match: AT1G15380.1 (AT1G15380.1 Lactoylglutathione lyase / glyoxalase I family protein) HSP 1 Score: 80.5 bits (197), Expect = 7.1e-16 Identity = 35/55 (63.64%), Postives = 43/55 (78.18%), Query Frame = 1
BLAST of Csa1G313810 vs. TAIR10
Match: AT2G28420.1 (AT2G28420.1 Lactoylglutathione lyase / glyoxalase I family protein) HSP 1 Score: 68.2 bits (165), Expect = 3.6e-12 Identity = 30/53 (56.60%), Postives = 39/53 (73.58%), Query Frame = 1
BLAST of Csa1G313810 vs. NCBI nr
Match: gi|449466995|ref|XP_004151211.1| (PREDICTED: uncharacterized protein LOC101203188 [Cucumis sativus]) HSP 1 Score: 220.7 bits (561), Expect = 1.2e-54 Identity = 107/107 (100.00%), Postives = 107/107 (100.00%), Query Frame = 1
BLAST of Csa1G313810 vs. NCBI nr
Match: gi|700210215|gb|KGN65311.1| (hypothetical protein Csa_1G313810 [Cucumis sativus]) HSP 1 Score: 220.7 bits (561), Expect = 1.2e-54 Identity = 107/107 (100.00%), Postives = 107/107 (100.00%), Query Frame = 1
BLAST of Csa1G313810 vs. NCBI nr
Match: gi|659130166|ref|XP_008465032.1| (PREDICTED: uncharacterized protein LOC103502748 [Cucumis melo]) HSP 1 Score: 203.4 bits (516), Expect = 2.0e-49 Identity = 99/108 (91.67%), Postives = 103/108 (95.37%), Query Frame = 1
BLAST of Csa1G313810 vs. NCBI nr
Match: gi|225445448|ref|XP_002285087.1| (PREDICTED: uncharacterized protein LOC100244070 [Vitis vinifera]) HSP 1 Score: 102.4 bits (254), Expect = 4.9e-19 Identity = 54/104 (51.92%), Postives = 74/104 (71.15%), Query Frame = 1
BLAST of Csa1G313810 vs. NCBI nr
Match: gi|698583359|ref|XP_009778075.1| (PREDICTED: uncharacterized protein LOC104227516 [Nicotiana sylvestris]) HSP 1 Score: 100.1 bits (248), Expect = 2.4e-18 Identity = 46/79 (58.23%), Postives = 60/79 (75.95%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|