Csa1G084320 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ACACTTCATTTATCTCAGCACACTTTCTTCATCGAAATCTCCATCAACCAAAGCAACCAACAATGTCCGGCAGAGGCAAAGGAGGAAAAGGTCTCGGAAAGGGAGGAGCCAAGAGGCATCGGAAAGTTCTGAGGGACAACATCCAAGGAATCACCAAGCCGGCCATCCGCCGTCTTGCTCGCCGTGGGGGCGTAAAGCGTATCAGCGGCCTGATCTATGAAGAAACTCGCGGCGTTCTCAAGATCTTCCTCGAAAATGTCATTCGTGACGCTGTCACTTACACTGAGCATGCTCGCCGGAAGACTGTCACCGCCATGGATGTTGTGTACGCGCTCAAGAGGCAAGGACGTACTTTATACGGCTTCGGAGGTTAGGGTTGTCGAAACCTAAGGTTTGGATTTGGGGGTTTTGTGGTTCGGTGATTTGGATGTGATTTTGGAGAGGAATTGTATATTATTGGTGATTTTGTTAGATTCAAACTATGATATCAGTCTGTAGGTTGTTAATTGTTTCTCTCGTAATTGGAAATCTTGATGCGCGTAATTAGAAACTGTTCTAGTTTTGTTCATCTTCAAGTTCACTATGTTTCTCTTCTGATTATTGGATCTGATTCTTAAAGCATAATTTTAGCTCTCAAGTAATTTCTAACTTCAAACTTGTTGCATCGATGTTCATAAAATCAAGATGAGATTGTTCATTAAATTTATATAATAATATCACATTAAACCTTGTACTC ATGTCCGGCAGAGGCAAAGGAGGAAAAGGTCTCGGAAAGGGAGGAGCCAAGAGGCATCGGAAAGTTCTGAGGGACAACATCCAAGGAATCACCAAGCCGGCCATCCGCCGTCTTGCTCGCCGTGGGGGCGTAAAGCGTATCAGCGGCCTGATCTATGAAGAAACTCGCGGCGTTCTCAAGATCTTCCTCGAAAATGTCATTCGTGACGCTGTCACTTACACTGAGCATGCTCGCCGGAAGACTGTCACCGCCATGGATGTTGTGTACGCGCTCAAGAGGCAAGGACGTACTTTATACGGCTTCGGAGGTTAG ATGTCCGGCAGAGGCAAAGGAGGAAAAGGTCTCGGAAAGGGAGGAGCCAAGAGGCATCGGAAAGTTCTGAGGGACAACATCCAAGGAATCACCAAGCCGGCCATCCGCCGTCTTGCTCGCCGTGGGGGCGTAAAGCGTATCAGCGGCCTGATCTATGAAGAAACTCGCGGCGTTCTCAAGATCTTCCTCGAAAATGTCATTCGTGACGCTGTCACTTACACTGAGCATGCTCGCCGGAAGACTGTCACCGCCATGGATGTTGTGTACGCGCTCAAGAGGCAAGGACGTACTTTATACGGCTTCGGAGGTTAG MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG*
BLAST of Csa1G084320 vs. Swiss-Prot
Match: H4_EUCGL (Histone H4 OS=Eucalyptus globulus PE=3 SV=3) HSP 1 Score: 206.1 bits (523), Expect = 1.9e-52 Identity = 103/103 (100.00%), Postives = 101/103 (98.06%), Query Frame = 1
BLAST of Csa1G084320 vs. Swiss-Prot
Match: H4_CHEMJ (Histone H4 OS=Chelidonium majus PE=3 SV=3) HSP 1 Score: 206.1 bits (523), Expect = 1.9e-52 Identity = 103/103 (100.00%), Postives = 101/103 (98.06%), Query Frame = 1
BLAST of Csa1G084320 vs. Swiss-Prot
Match: H4_ARATH (Histone H4 OS=Arabidopsis thaliana GN=At1g07660 PE=1 SV=2) HSP 1 Score: 206.1 bits (523), Expect = 1.9e-52 Identity = 103/103 (100.00%), Postives = 101/103 (98.06%), Query Frame = 1
BLAST of Csa1G084320 vs. Swiss-Prot
Match: H41_WHEAT (Histone H4 variant TH011 OS=Triticum aestivum PE=3 SV=2) HSP 1 Score: 206.1 bits (523), Expect = 1.9e-52 Identity = 103/103 (100.00%), Postives = 101/103 (98.06%), Query Frame = 1
BLAST of Csa1G084320 vs. Swiss-Prot
Match: H4_PEA (Histone H4 OS=Pisum sativum PE=1 SV=2) HSP 1 Score: 206.1 bits (523), Expect = 1.9e-52 Identity = 103/103 (100.00%), Postives = 101/103 (98.06%), Query Frame = 1
BLAST of Csa1G084320 vs. TrEMBL
Match: Q6NR90_ARATH (Histone H4 OS=Arabidopsis thaliana GN=At1g07660 PE=2 SV=1) HSP 1 Score: 206.1 bits (523), Expect = 2.1e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 1
BLAST of Csa1G084320 vs. TrEMBL
Match: L0P1L9_9POAL (Histone H4 OS=Phyllostachys edulis GN=PH01B001I13.20 PE=3 SV=1) HSP 1 Score: 206.1 bits (523), Expect = 2.1e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 1
BLAST of Csa1G084320 vs. TrEMBL
Match: A0A0B2SBA2_GLYSO (Histone H4 OS=Glycine soja GN=glysoja_005470 PE=3 SV=1) HSP 1 Score: 206.1 bits (523), Expect = 2.1e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 1
BLAST of Csa1G084320 vs. TrEMBL
Match: A0A0A0LSH2_CUCSA (Histone H4 OS=Cucumis sativus GN=Csa_1G084320 PE=3 SV=1) HSP 1 Score: 206.1 bits (523), Expect = 2.1e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 1
BLAST of Csa1G084320 vs. TrEMBL
Match: A0A0D3C2P6_BRAOL (Histone H4 OS=Brassica oleracea var. oleracea PE=3 SV=1) HSP 1 Score: 206.1 bits (523), Expect = 2.1e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 1
BLAST of Csa1G084320 vs. TAIR10
Match: AT1G07660.1 (AT1G07660.1 Histone superfamily protein) HSP 1 Score: 206.1 bits (523), Expect = 1.1e-53 Identity = 103/103 (100.00%), Postives = 101/103 (98.06%), Query Frame = 1
BLAST of Csa1G084320 vs. TAIR10
Match: AT1G07820.1 (AT1G07820.1 Histone superfamily protein) HSP 1 Score: 206.1 bits (523), Expect = 1.1e-53 Identity = 103/103 (100.00%), Postives = 101/103 (98.06%), Query Frame = 1
BLAST of Csa1G084320 vs. TAIR10
Match: AT2G28740.1 (AT2G28740.1 histone H4) HSP 1 Score: 206.1 bits (523), Expect = 1.1e-53 Identity = 103/103 (100.00%), Postives = 101/103 (98.06%), Query Frame = 1
BLAST of Csa1G084320 vs. TAIR10
Match: AT3G45930.1 (AT3G45930.1 Histone superfamily protein) HSP 1 Score: 206.1 bits (523), Expect = 1.1e-53 Identity = 103/103 (100.00%), Postives = 101/103 (98.06%), Query Frame = 1
BLAST of Csa1G084320 vs. TAIR10
Match: AT3G53730.1 (AT3G53730.1 Histone superfamily protein) HSP 1 Score: 206.1 bits (523), Expect = 1.1e-53 Identity = 103/103 (100.00%), Postives = 101/103 (98.06%), Query Frame = 1
BLAST of Csa1G084320 vs. NCBI nr
Match: gi|976922550|gb|KVI06931.1| (Histone core [Cynara cardunculus var. scolymus]) HSP 1 Score: 206.1 bits (523), Expect = 3.0e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 1
BLAST of Csa1G084320 vs. NCBI nr
Match: gi|629086337|gb|KCW52694.1| (hypothetical protein EUGRSUZ_J02062, partial [Eucalyptus grandis]) HSP 1 Score: 206.1 bits (523), Expect = 3.0e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 1
BLAST of Csa1G084320 vs. NCBI nr
Match: gi|413947466|gb|AFW80115.1| (hypothetical protein ZEAMMB73_313798 [Zea mays]) HSP 1 Score: 206.1 bits (523), Expect = 3.0e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 1
BLAST of Csa1G084320 vs. NCBI nr
Match: gi|960491942|ref|XP_014751185.1| (PREDICTED: uncharacterized protein LOC100841093 [Brachypodium distachyon]) HSP 1 Score: 206.1 bits (523), Expect = 3.0e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 1
BLAST of Csa1G084320 vs. NCBI nr
Match: gi|960491942|ref|XP_014751185.1| (PREDICTED: uncharacterized protein LOC100841093 [Brachypodium distachyon]) HSP 1 Score: 206.1 bits (523), Expect = 3.0e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 1
HSP 2 Score: 206.1 bits (523), Expect = 3.0e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|