Csa1G073610 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTTGGTGTGACGATCCGAACCACAAAGGTCAGAACATGGGAATCTTCTACTCCGCCGCAAGAGACCCAATTTTCTACACCCATCACGCCAACGTCGATCGCTGTAGTCAATCTGGAAGTCCATCAACTGAAGGCGCAAAGACATTCCGACCCCGATTTCCTCAACACTTCCTTACTCTTCTACAACGAGAAAGCTGAACCCGTCTGTGTCTACGTTCGTGACTCTCTTGACACTAAAAAACTCGGCTACGTCTTCCAATCTATTGACATCCCATGGCTCAAATCTCGCCCCAAGCCTCTTAACAAGAAGGTCAAGTCCAAGAAGTCTATTGCTGCTAGCATTGTCCCATTCGGTGTTGGTGCAGCCCTTGATGAAAAAGCAAAGTCGATACACTTAAGAATAAAAATGCTTTGTAGAAGGAGGAATAATTGGCAAGAGAAAATCCTAACTTTTTATATATATGACTCCATGGTTTTTTGA ATGCTTGGTGTGACGATCCGAACCACAAAGGTCAGAACATGGGAATCTTCTACTCCGCCGCAAGAGACCCAATTTTCTACACCCATCACGCCAACGTCGATCGCTGTAGTCAATCTGGAAGTCCATCAACTGAAGGCGCAAAGACATTCCGACCCCGATTTCCTCAACACTTCCTTACTCTTCTACAACGAGAAAGCTGAACCCGTCTGTGTCTACGTTCGTGACTCTCTTGACACTAAAAAACTCGGCTACGTCTTCCAATCTATTGACATCCCATGGCTCAAATCTCGCCCCAAGCCTCTTAACAAGAAGGTCAAGTCCAAGAAGTCTATTGCTGCTAGCATTGTCCCATTCGGTGTTGGTGCAGCCCTTGATGAAAAAGCAAAGTCGATACACTTAAGAATAAAAATGCTTTGTAGAAGGAGGAATAATTGGCAAGAGAAAATCCTAACTTTTTATATATATGACTCCATGGTTTTTTGA ATGCTTGGTGTGACGATCCGAACCACAAAGGTCAGAACATGGGAATCTTCTACTCCGCCGCAAGAGACCCAATTTTCTACACCCATCACGCCAACGTCGATCGCTGTAGTCAATCTGGAAGTCCATCAACTGAAGGCGCAAAGACATTCCGACCCCGATTTCCTCAACACTTCCTTACTCTTCTACAACGAGAAAGCTGAACCCGTCTGTGTCTACGTTCGTGACTCTCTTGACACTAAAAAACTCGGCTACGTCTTCCAATCTATTGACATCCCATGGCTCAAATCTCGCCCCAAGCCTCTTAACAAGAAGGTCAAGTCCAAGAAGTCTATTGCTGCTAGCATTGTCCCATTCGGTGTTGGTGCAGCCCTTGATGAAAAAGCAAAGTCGATACACTTAAGAATAAAAATGCTTTGTAGAAGGAGGAATAATTGGCAAGAGAAAATCCTAACTTTTTATATATATGACTCCATGGTTTTTTGA MLGVTIRTTKVRTWESSTPPQETQFSTPITPTSIAVVNLEVHQLKAQRHSDPDFLNTSLLFYNEKAEPVCVYVRDSLDTKKLGYVFQSIDIPWLKSRPKPLNKKVKSKKSIAASIVPFGVGAALDEKAKSIHLRIKMLCRRRNNWQEKILTFYIYDSMVF*
BLAST of Csa1G073610 vs. Swiss-Prot
Match: AS1_ANTMA (Aureusidin synthase OS=Antirrhinum majus GN=AS1 PE=1 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 3.9e-12 Identity = 32/51 (62.75%), Postives = 38/51 (74.51%), Query Frame = 1
BLAST of Csa1G073610 vs. Swiss-Prot
Match: PPO_MALDO (Polyphenol oxidase, chloroplastic OS=Malus domestica PE=2 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 3.9e-12 Identity = 34/60 (56.67%), Postives = 40/60 (66.67%), Query Frame = 1
BLAST of Csa1G073610 vs. Swiss-Prot
Match: LAHY_LARTR ((+)-larreatricin hydroxylase, chloroplastic OS=Larrea tridentata PE=1 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.9e-11 Identity = 29/59 (49.15%), Postives = 40/59 (67.80%), Query Frame = 1
BLAST of Csa1G073610 vs. Swiss-Prot
Match: PPO1_IPOBA (Polyphenol oxidase I, chloroplastic OS=Ipomoea batatas GN=co-1 PE=1 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.4e-09 Identity = 31/73 (42.47%), Postives = 42/73 (57.53%), Query Frame = 1
BLAST of Csa1G073610 vs. Swiss-Prot
Match: PPO_VICFA (Polyphenol oxidase A1, chloroplastic OS=Vicia faba PE=1 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 3.4e-08 Identity = 28/62 (45.16%), Postives = 36/62 (58.06%), Query Frame = 1
BLAST of Csa1G073610 vs. TrEMBL
Match: A0A0A0LSA5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G073610 PE=4 SV=1) HSP 1 Score: 323.9 bits (829), Expect = 1.1e-85 Identity = 160/160 (100.00%), Postives = 160/160 (100.00%), Query Frame = 1
BLAST of Csa1G073610 vs. TrEMBL
Match: A0A0A0LUI6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G073620 PE=4 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 5.5e-21 Identity = 66/123 (53.66%), Postives = 77/123 (62.60%), Query Frame = 1
BLAST of Csa1G073610 vs. TrEMBL
Match: A0A0U2D7M5_LUFAE (Polyphenol oxidase OS=Luffa aegyptiaca PE=2 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 1.8e-19 Identity = 51/82 (62.20%), Postives = 58/82 (70.73%), Query Frame = 1
BLAST of Csa1G073610 vs. TrEMBL
Match: A0A151R8K1_CAJCA (Uncharacterized protein OS=Cajanus cajan GN=KK1_039853 PE=4 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 3.2e-13 Identity = 42/104 (40.38%), Postives = 65/104 (62.50%), Query Frame = 1
BLAST of Csa1G073610 vs. TrEMBL
Match: K7M0F1_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 2.1e-12 Identity = 40/87 (45.98%), Postives = 57/87 (65.52%), Query Frame = 1
BLAST of Csa1G073610 vs. NCBI nr
Match: gi|700209557|gb|KGN64653.1| (hypothetical protein Csa_1G073610 [Cucumis sativus]) HSP 1 Score: 323.9 bits (829), Expect = 1.5e-85 Identity = 160/160 (100.00%), Postives = 160/160 (100.00%), Query Frame = 1
BLAST of Csa1G073610 vs. NCBI nr
Match: gi|700209558|gb|KGN64654.1| (hypothetical protein Csa_1G073620 [Cucumis sativus]) HSP 1 Score: 109.0 bits (271), Expect = 7.8e-21 Identity = 66/123 (53.66%), Postives = 77/123 (62.60%), Query Frame = 1
BLAST of Csa1G073610 vs. NCBI nr
Match: gi|844289600|gb|AKN08990.1| (polyphenol oxidase [Luffa aegyptiaca]) HSP 1 Score: 104.0 bits (258), Expect = 2.5e-19 Identity = 51/82 (62.20%), Postives = 58/82 (70.73%), Query Frame = 1
BLAST of Csa1G073610 vs. NCBI nr
Match: gi|1012327131|gb|KYP38872.1| (hypothetical protein KK1_039853 [Cajanus cajan]) HSP 1 Score: 83.2 bits (204), Expect = 4.6e-13 Identity = 42/104 (40.38%), Postives = 65/104 (62.50%), Query Frame = 1
BLAST of Csa1G073610 vs. NCBI nr
Match: gi|1009169964|ref|XP_015865948.1| (PREDICTED: polyphenol oxidase, chloroplastic-like [Ziziphus jujuba]) HSP 1 Score: 81.6 bits (200), Expect = 1.3e-12 Identity = 41/78 (52.56%), Postives = 51/78 (65.38%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |