Csa1G071250 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAACAATGGTGATGATATGAAGCATGATAAAGTGAATCAAGTTAAGCTCCAAGAGCTGCCTCTTTTTGATTTTGAGAAGTTGGCTACTGCAACTAACCATTTTCATTTCAATAACAAGCTTGGTCAGGGTGGGTTTGGGCCAGTGTACAAGGTGGGAATAAAGTTGTTCTTTCTTTTTGTTGATTAA ATGAACAATGGTGATGATATGAAGCATGATAAAGTGAATCAAGTTAAGCTCCAAGAGCTGCCTCTTTTTGATTTTGAGAAGTTGGCTACTGCAACTAACCATTTTCATTTCAATAACAAGCTTGGTCAGGGTGGGTTTGGGCCAGTGTACAAGGTGGGAATAAAGTTGTTCTTTCTTTTTGTTGATTAA ATGAACAATGGTGATGATATGAAGCATGATAAAGTGAATCAAGTTAAGCTCCAAGAGCTGCCTCTTTTTGATTTTGAGAAGTTGGCTACTGCAACTAACCATTTTCATTTCAATAACAAGCTTGGTCAGGGTGGGTTTGGGCCAGTGTACAAGGTGGGAATAAAGTTGTTCTTTCTTTTTGTTGATTAA MNNGDDMKHDKVNQVKLQELPLFDFEKLATATNHFHFNNKLGQGGFGPVYKVGIKLFFLFVD*
BLAST of Csa1G071250 vs. Swiss-Prot
Match: Y1133_ARATH (G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330 OS=Arabidopsis thaliana GN=At1g11330 PE=2 SV=3) HSP 1 Score: 64.3 bits (155), Expect = 5.4e-10 Identity = 28/39 (71.79%), Postives = 32/39 (82.05%), Query Frame = 1
BLAST of Csa1G071250 vs. Swiss-Prot
Match: SD113_ARATH (G-type lectin S-receptor-like serine/threonine-protein kinase SD1-13 OS=Arabidopsis thaliana GN=SD113 PE=1 SV=2) HSP 1 Score: 63.2 bits (152), Expect = 1.2e-09 Identity = 29/40 (72.50%), Postives = 31/40 (77.50%), Query Frame = 1
BLAST of Csa1G071250 vs. Swiss-Prot
Match: Y1130_ARATH (G-type lectin S-receptor-like serine/threonine-protein kinase At1g11300 OS=Arabidopsis thaliana GN=At1g11300 PE=2 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 2.1e-09 Identity = 28/39 (71.79%), Postives = 31/39 (79.49%), Query Frame = 1
BLAST of Csa1G071250 vs. Swiss-Prot
Match: Y1135_ARATH (G-type lectin S-receptor-like serine/threonine-protein kinase At1g11305 OS=Arabidopsis thaliana GN=At1g11305 PE=3 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 4.6e-09 Identity = 27/36 (75.00%), Postives = 31/36 (86.11%), Query Frame = 1
BLAST of Csa1G071250 vs. Swiss-Prot
Match: Y1141_ARATH (G-type lectin S-receptor-like serine/threonine-protein kinase At1g11410 OS=Arabidopsis thaliana GN=At1g11410 PE=3 SV=3) HSP 1 Score: 55.5 bits (132), Expect = 2.5e-07 Identity = 24/34 (70.59%), Postives = 26/34 (76.47%), Query Frame = 1
BLAST of Csa1G071250 vs. TrEMBL
Match: A0A0A0LX96_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G071250 PE=4 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 8.1e-29 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 1
BLAST of Csa1G071250 vs. TrEMBL
Match: A0A072TZ31_MEDTR (G-type lectin S-receptor-like Serine/Threonine-kinase OS=Medicago truncatula GN=MTR_7g056510 PE=4 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.2e-11 Identity = 37/51 (72.55%), Postives = 44/51 (86.27%), Query Frame = 1
BLAST of Csa1G071250 vs. TrEMBL
Match: A5BH08_VITVI (Serine/threonine-protein kinase OS=Vitis vinifera GN=VITISV_024703 PE=3 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 3.4e-11 Identity = 35/43 (81.40%), Postives = 38/43 (88.37%), Query Frame = 1
BLAST of Csa1G071250 vs. TrEMBL
Match: A0A072TZS6_MEDTR (Serine/threonine-protein kinase OS=Medicago truncatula GN=MTR_7g056510 PE=3 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 3.4e-11 Identity = 36/50 (72.00%), Postives = 43/50 (86.00%), Query Frame = 1
BLAST of Csa1G071250 vs. TrEMBL
Match: A0A072TYW2_MEDTR (Serine/threonine-protein kinase OS=Medicago truncatula GN=MTR_7g056510 PE=3 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 3.4e-11 Identity = 36/50 (72.00%), Postives = 43/50 (86.00%), Query Frame = 1
BLAST of Csa1G071250 vs. TAIR10
Match: AT1G11330.2 (AT1G11330.2 S-locus lectin protein kinase family protein) HSP 1 Score: 64.3 bits (155), Expect = 3.1e-11 Identity = 28/39 (71.79%), Postives = 32/39 (82.05%), Query Frame = 1
BLAST of Csa1G071250 vs. TAIR10
Match: AT1G11350.1 (AT1G11350.1 S-domain-1 13) HSP 1 Score: 63.2 bits (152), Expect = 6.8e-11 Identity = 29/40 (72.50%), Postives = 31/40 (77.50%), Query Frame = 1
BLAST of Csa1G071250 vs. TAIR10
Match: AT1G11300.1 (AT1G11300.1 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding) HSP 1 Score: 62.4 bits (150), Expect = 1.2e-10 Identity = 28/39 (71.79%), Postives = 31/39 (79.49%), Query Frame = 1
HSP 2 Score: 61.2 bits (147), Expect = 2.6e-10 Identity = 27/36 (75.00%), Postives = 31/36 (86.11%), Query Frame = 1
BLAST of Csa1G071250 vs. TAIR10
Match: AT1G11410.1 (AT1G11410.1 S-locus lectin protein kinase family protein) HSP 1 Score: 55.5 bits (132), Expect = 1.4e-08 Identity = 24/34 (70.59%), Postives = 26/34 (76.47%), Query Frame = 1
BLAST of Csa1G071250 vs. TAIR10
Match: AT1G61370.1 (AT1G61370.1 S-locus lectin protein kinase family protein) HSP 1 Score: 51.6 bits (122), Expect = 2.0e-07 Identity = 22/38 (57.89%), Postives = 26/38 (68.42%), Query Frame = 1
BLAST of Csa1G071250 vs. NCBI nr
Match: gi|700209515|gb|KGN64611.1| (hypothetical protein Csa_1G071250 [Cucumis sativus]) HSP 1 Score: 133.7 bits (335), Expect = 1.2e-28 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 1
BLAST of Csa1G071250 vs. NCBI nr
Match: gi|778664919|ref|XP_011648441.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101215697 [Cucumis sativus]) HSP 1 Score: 112.5 bits (280), Expect = 2.8e-22 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 1
BLAST of Csa1G071250 vs. NCBI nr
Match: gi|778664919|ref|XP_011648441.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101215697 [Cucumis sativus]) HSP 1 Score: 40.4 bits (93), Expect = 1.3e+00 Identity = 15/25 (60.00%), Postives = 21/25 (84.00%), Query Frame = 1
HSP 2 Score: 112.5 bits (280), Expect = 2.8e-22 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 1
BLAST of Csa1G071250 vs. NCBI nr
Match: gi|659068837|ref|XP_008446560.1| (PREDICTED: uncharacterized protein LOC103489252 [Cucumis melo]) HSP 1 Score: 39.7 bits (91), Expect = 2.3e+00 Identity = 19/50 (38.00%), Postives = 30/50 (60.00%), Query Frame = 1
HSP 2 Score: 76.6 bits (187), Expect = 1.7e-11 Identity = 37/51 (72.55%), Postives = 44/51 (86.27%), Query Frame = 1
BLAST of Csa1G071250 vs. NCBI nr
Match: gi|147811071|emb|CAN70167.1| (hypothetical protein VITISV_024703 [Vitis vinifera]) HSP 1 Score: 75.1 bits (183), Expect = 4.9e-11 Identity = 35/43 (81.40%), Postives = 38/43 (88.37%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |