Csa1G064830 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCATCCATTGTTCTTATGCTTAATAGTTATTCGGTTACATTGCCAATACCTAAAGAGCCAGCATTGTTCATGCGGAGTAAAGACAATAATGGCACTACTATAGGCAGTGATCATTCTTCTAATAAGTCTACTACTAAGTGGTCTGTCAATGAAACATCTATATCTGAATTGCATCCACGATGAAGCTAACTAAGTATGTCT ATGGCATCCATTGTTCTTATGCTTAATAGTTATTCGGTTACATTGCCAATACCTAAAGAGCCAGCATTGTTCATGCGGAGTAAAGACAATAATGGCACTACTATAGGCAGTGATCATTCTTCTAATAAGTCTACTACTAAGTGGTCTGTCAATGAAACATCTATATCTGAATTGCATCCACGATGA ATGGCATCCATTGTTCTTATGCTTAATAGTTATTCGGTTACATTGCCAATACCTAAAGAGCCAGCATTGTTCATGCGGAGTAAAGACAATAATGGCACTACTATAGGCAGTGATCATTCTTCTAATAAGTCTACTACTAAGTGGTCTGTCAATGAAACATCTATATCTGAATTGCATCCACGATGA MASIVLMLNSYSVTLPIPKEPALFMRSKDNNGTTIGSDHSSNKSTTKWSVNETSISELHPR*
BLAST of Csa1G064830 vs. Swiss-Prot
Match: CRK10_ARATH (Cysteine-rich receptor-like protein kinase 10 OS=Arabidopsis thaliana GN=CRK10 PE=1 SV=3) HSP 1 Score: 50.8 bits (120), Expect = 6.1e-06 Identity = 27/64 (42.19%), Postives = 41/64 (64.06%), Query Frame = 1
BLAST of Csa1G064830 vs. TrEMBL
Match: A0A0A0LX60_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G064830 PE=4 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 3.7e-26 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 1
BLAST of Csa1G064830 vs. TrEMBL
Match: F6HTL8_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_03s0017g01550 PE=3 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 3.4e-11 Identity = 40/64 (62.50%), Postives = 51/64 (79.69%), Query Frame = 1
BLAST of Csa1G064830 vs. TrEMBL
Match: A5BD87_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_034184 PE=3 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 3.4e-11 Identity = 40/64 (62.50%), Postives = 51/64 (79.69%), Query Frame = 1
BLAST of Csa1G064830 vs. TrEMBL
Match: F6HWQ6_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_00s0366g00020 PE=3 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.3e-10 Identity = 40/63 (63.49%), Postives = 50/63 (79.37%), Query Frame = 1
BLAST of Csa1G064830 vs. TrEMBL
Match: V4UDW1_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10014504mg PE=3 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 2.4e-09 Identity = 35/64 (54.69%), Postives = 47/64 (73.44%), Query Frame = 1
BLAST of Csa1G064830 vs. TAIR10
Match: AT4G23180.1 (AT4G23180.1 cysteine-rich RLK (RECEPTOR-like protein kinase) 10) HSP 1 Score: 50.8 bits (120), Expect = 3.4e-07 Identity = 27/64 (42.19%), Postives = 41/64 (64.06%), Query Frame = 1
BLAST of Csa1G064830 vs. TAIR10
Match: AT4G05200.1 (AT4G05200.1 cysteine-rich RLK (RECEPTOR-like protein kinase) 25) HSP 1 Score: 48.5 bits (114), Expect = 1.7e-06 Identity = 25/65 (38.46%), Postives = 38/65 (58.46%), Query Frame = 1
BLAST of Csa1G064830 vs. NCBI nr
Match: gi|700209465|gb|KGN64561.1| (hypothetical protein Csa_1G064830 [Cucumis sativus]) HSP 1 Score: 124.8 bits (312), Expect = 5.3e-26 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 1
BLAST of Csa1G064830 vs. NCBI nr
Match: gi|449472233|ref|XP_004153532.1| (PREDICTED: cysteine-rich receptor-like protein kinase 10 [Cucumis sativus]) HSP 1 Score: 124.8 bits (312), Expect = 5.3e-26 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 1
BLAST of Csa1G064830 vs. NCBI nr
Match: gi|659068815|ref|XP_008446411.1| (PREDICTED: cysteine-rich receptor-like protein kinase 10 [Cucumis melo]) HSP 1 Score: 102.1 bits (253), Expect = 3.7e-19 Identity = 55/61 (90.16%), Postives = 57/61 (93.44%), Query Frame = 1
BLAST of Csa1G064830 vs. NCBI nr
Match: gi|659068815|ref|XP_008446411.1| (PREDICTED: cysteine-rich receptor-like protein kinase 10 [Cucumis melo]) HSP 1 Score: 57.0 bits (136), Expect = 1.4e-05 Identity = 32/59 (54.24%), Postives = 39/59 (66.10%), Query Frame = 1
HSP 2 Score: 75.1 bits (183), Expect = 4.8e-11 Identity = 40/64 (62.50%), Postives = 51/64 (79.69%), Query Frame = 1
BLAST of Csa1G064830 vs. NCBI nr
Match: gi|731384580|ref|XP_010648189.1| (PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform X1 [Vitis vinifera]) HSP 1 Score: 75.1 bits (183), Expect = 4.8e-11 Identity = 40/64 (62.50%), Postives = 51/64 (79.69%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |