Csa1G030660 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGAAAACTGTACTGATTGTTAATTTGGAGGTAAAAGATAACCACGAGGAGGCAGCCATAGGAGCGCGACTTACTTTTGATCTTTGCCAGGAGGTCTGGCTCTCTAACTCTCTTGATTTTATTTTATTCATTATCCGTTTGTGTCGATGGAGTTTTATGGAATATCTTTTCATGATAGATTGAACGGACTGAATCATGGGAAGATTCTATAGATGACATCGTGATTAACTTCGAAAAACAGCTGAGAAGAAAACTGTTGTATAGCATTTCCTTTTACTGA ATGATGAAAACTGTACTGATTGTTAATTTGGAGGTAAAAGATAACCACGAGGAGGCAGCCATAGGAGCGCGACTTACTTTTGATCTTTGCCAGGAGATTGAACGGACTGAATCATGGGAAGATTCTATAGATGACATCGTGATTAACTTCGAAAAACAGCTGAGAAGAAAACTGTTGTATAGCATTTCCTTTTACTGA ATGATGAAAACTGTACTGATTGTTAATTTGGAGGTAAAAGATAACCACGAGGAGGCAGCCATAGGAGCGCGACTTACTTTTGATCTTTGCCAGGAGATTGAACGGACTGAATCATGGGAAGATTCTATAGATGACATCGTGATTAACTTCGAAAAACAGCTGAGAAGAAAACTGTTGTATAGCATTTCCTTTTACTGA MMKTVLIVNLEVKDNHEEAAIGARLTFDLCQEIERTESWEDSIDDIVINFEKQLRRKLLYSISFY*
BLAST of Csa1G030660 vs. Swiss-Prot
Match: SSU72_MOUSE (RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Mus musculus GN=Ssu72 PE=1 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 2.8e-09 Identity = 27/61 (44.26%), Postives = 42/61 (68.85%), Query Frame = 1
BLAST of Csa1G030660 vs. Swiss-Prot
Match: SSU72_RAT (RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Rattus norvegicus GN=Ssu72 PE=2 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 2.8e-09 Identity = 27/61 (44.26%), Postives = 42/61 (68.85%), Query Frame = 1
BLAST of Csa1G030660 vs. Swiss-Prot
Match: SSU72_HUMAN (RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Homo sapiens GN=SSU72 PE=1 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 2.8e-09 Identity = 27/61 (44.26%), Postives = 42/61 (68.85%), Query Frame = 1
BLAST of Csa1G030660 vs. Swiss-Prot
Match: SSU72_BOVIN (RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Bos taurus GN=SSU72 PE=2 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 3.7e-09 Identity = 26/61 (42.62%), Postives = 42/61 (68.85%), Query Frame = 1
BLAST of Csa1G030660 vs. Swiss-Prot
Match: SSU72_CHICK (RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Gallus gallus GN=SSU72 PE=2 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 3.7e-09 Identity = 26/61 (42.62%), Postives = 42/61 (68.85%), Query Frame = 1
BLAST of Csa1G030660 vs. TrEMBL
Match: A0A0A0LPW0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G030660 PE=4 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 4.2e-28 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 1
BLAST of Csa1G030660 vs. TrEMBL
Match: D7T1F4_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_06s0009g01900 PE=4 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 4.1e-23 Identity = 54/65 (83.08%), Postives = 59/65 (90.77%), Query Frame = 1
BLAST of Csa1G030660 vs. TrEMBL
Match: A0A067DWF9_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g029458mg PE=4 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 3.4e-22 Identity = 53/64 (82.81%), Postives = 58/64 (90.62%), Query Frame = 1
BLAST of Csa1G030660 vs. TrEMBL
Match: V4SC52_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10005966mg PE=4 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 3.4e-22 Identity = 53/64 (82.81%), Postives = 58/64 (90.62%), Query Frame = 1
BLAST of Csa1G030660 vs. TrEMBL
Match: I3S5R7_LOTJA (Uncharacterized protein OS=Lotus japonicus PE=2 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 4.5e-22 Identity = 52/65 (80.00%), Postives = 59/65 (90.77%), Query Frame = 1
BLAST of Csa1G030660 vs. TAIR10
Match: AT1G73820.1 (AT1G73820.1 Ssu72-like family protein) HSP 1 Score: 103.6 bits (257), Expect = 4.8e-23 Identity = 48/65 (73.85%), Postives = 54/65 (83.08%), Query Frame = 1
BLAST of Csa1G030660 vs. NCBI nr
Match: gi|449439211|ref|XP_004137380.1| (PREDICTED: RNA polymerase II subunit A C-terminal domain phosphatase SSU72 [Cucumis sativus]) HSP 1 Score: 131.3 bits (329), Expect = 6.0e-28 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 1
BLAST of Csa1G030660 vs. NCBI nr
Match: gi|700208844|gb|KGN63940.1| (hypothetical protein Csa_1G030660 [Cucumis sativus]) HSP 1 Score: 131.3 bits (329), Expect = 6.0e-28 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 1
BLAST of Csa1G030660 vs. NCBI nr
Match: gi|659066237|ref|XP_008446784.1| (PREDICTED: RNA polymerase II subunit A C-terminal domain phosphatase SSU72 [Cucumis melo]) HSP 1 Score: 127.9 bits (320), Expect = 6.7e-27 Identity = 63/65 (96.92%), Postives = 64/65 (98.46%), Query Frame = 1
BLAST of Csa1G030660 vs. NCBI nr
Match: gi|225435973|ref|XP_002271255.1| (PREDICTED: RNA polymerase II subunit A C-terminal domain phosphatase SSU72 [Vitis vinifera]) HSP 1 Score: 114.8 bits (286), Expect = 5.8e-23 Identity = 54/65 (83.08%), Postives = 59/65 (90.77%), Query Frame = 1
BLAST of Csa1G030660 vs. NCBI nr
Match: gi|502164958|ref|XP_004513347.1| (PREDICTED: RNA polymerase II subunit A C-terminal domain phosphatase SSU72 [Cicer arietinum]) HSP 1 Score: 114.8 bits (286), Expect = 5.8e-23 Identity = 54/65 (83.08%), Postives = 60/65 (92.31%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |