Csa1G012090 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TTGTGATGCCAAAGAAAGTCTTCGTCAAATCCCTAAACTTTCTTTCACTAAACTATTCTATCGATTTCTTCGAAAATGGCGTCCCCAACGAGATCGGAGGCCCTTTCGCTTCTTCGCTCTCTGATCCGTACAGCCCGTCACTTCTCCGATTACAACATCAGAGAGTACGCCAAACGACGCGCGGTCGATGGCTTCCGCCATAACCGAAACCTTTCCGATCCTCCATCCATTTCTTCCGCCTATGCCGATGGCAAGGCTCAGCTTGAAGTTGCTAAAAGACAGTCCGCCGTTTACTCCCTCTATGGGCCGAAGGTAAAGAGCATCATGGAGGCTCATCGCATAAACTGAATACGGAAGCTCTTTTTCCTTAATTTATTGTAATTCTAATTCTATTGTGATAGATTTCGTGAGTAAGGGTTTATTTCTGCTTCACGGATCATACCTTTTCTACTAAGAATTTAATAAATCGTTTGAGTAATTAATCCTTGACTGTGGGATGAAATATGAAATATTTGGTGATGATGAAAACATGATTACACTGATCTT ATGGCGTCCCCAACGAGATCGGAGGCCCTTTCGCTTCTTCGCTCTCTGATCCGTACAGCCCGTCACTTCTCCGATTACAACATCAGAGAGTACGCCAAACGACGCGCGGTCGATGGCTTCCGCCATAACCGAAACCTTTCCGATCCTCCATCCATTTCTTCCGCCTATGCCGATGGCAAGGCTCAGCTTGAAGTTGCTAAAAGACAGTCCGCCGTTTACTCCCTCTATGGGCCGAAGGTAAAGAGCATCATGGAGGCTCATCGCATAAACTGA ATGGCGTCCCCAACGAGATCGGAGGCCCTTTCGCTTCTTCGCTCTCTGATCCGTACAGCCCGTCACTTCTCCGATTACAACATCAGAGAGTACGCCAAACGACGCGCGGTCGATGGCTTCCGCCATAACCGAAACCTTTCCGATCCTCCATCCATTTCTTCCGCCTATGCCGATGGCAAGGCTCAGCTTGAAGTTGCTAAAAGACAGTCCGCCGTTTACTCCCTCTATGGGCCGAAGGTAAAGAGCATCATGGAGGCTCATCGCATAAACTGA MASPTRSEALSLLRSLIRTARHFSDYNIREYAKRRAVDGFRHNRNLSDPPSISSAYADGKAQLEVAKRQSAVYSLYGPKVKSIMEAHRIN*
BLAST of Csa1G012090 vs. Swiss-Prot
Match: LYRM4_MOUSE (LYR motif-containing protein 4 OS=Mus musculus GN=Lyrm4 PE=1 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 7.1e-11 Identity = 32/76 (42.11%), Postives = 45/76 (59.21%), Query Frame = 1
BLAST of Csa1G012090 vs. Swiss-Prot
Match: LYRM4_TAEGU (LYR motif-containing protein 4 OS=Taeniopygia guttata GN=LYRM4 PE=3 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 2.1e-10 Identity = 35/85 (41.18%), Postives = 49/85 (57.65%), Query Frame = 1
BLAST of Csa1G012090 vs. Swiss-Prot
Match: LYRM4_HUMAN (LYR motif-containing protein 4 OS=Homo sapiens GN=LYRM4 PE=1 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 6.0e-10 Identity = 32/76 (42.11%), Postives = 44/76 (57.89%), Query Frame = 1
BLAST of Csa1G012090 vs. Swiss-Prot
Match: LYRM4_BOVIN (LYR motif-containing protein 4 OS=Bos taurus GN=LYRM4 PE=3 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.5e-08 Identity = 28/76 (36.84%), Postives = 42/76 (55.26%), Query Frame = 1
BLAST of Csa1G012090 vs. Swiss-Prot
Match: ISD11_YEAST (Protein ISD11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISD11 PE=1 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 2.5e-08 Identity = 28/74 (37.84%), Postives = 39/74 (52.70%), Query Frame = 1
BLAST of Csa1G012090 vs. TrEMBL
Match: A0A0A0LPH2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G012090 PE=3 SV=1) HSP 1 Score: 178.3 bits (451), Expect = 4.1e-42 Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 1
BLAST of Csa1G012090 vs. TrEMBL
Match: K4BL51_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=3 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 1.4e-26 Identity = 57/88 (64.77%), Postives = 75/88 (85.23%), Query Frame = 1
BLAST of Csa1G012090 vs. TrEMBL
Match: A0A0V0GXH7_SOLCH (Putative LYR motif-containing protein 4-like OS=Solanum chacoense PE=3 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 1.4e-26 Identity = 57/88 (64.77%), Postives = 75/88 (85.23%), Query Frame = 1
BLAST of Csa1G012090 vs. TrEMBL
Match: M1CAK5_SOLTU (Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400024653 PE=3 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 1.4e-26 Identity = 57/88 (64.77%), Postives = 75/88 (85.23%), Query Frame = 1
BLAST of Csa1G012090 vs. TrEMBL
Match: A0A059D0E2_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_B00568 PE=3 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 3.2e-26 Identity = 57/87 (65.52%), Postives = 75/87 (86.21%), Query Frame = 1
BLAST of Csa1G012090 vs. TAIR10
Match: AT5G61220.1 (AT5G61220.1 LYR family of Fe/S cluster biogenesis protein) HSP 1 Score: 97.4 bits (241), Expect = 4.7e-21 Identity = 47/79 (59.49%), Postives = 56/79 (70.89%), Query Frame = 1
BLAST of Csa1G012090 vs. NCBI nr
Match: gi|778656045|ref|XP_011660289.1| (PREDICTED: LYR motif-containing protein 4 [Cucumis sativus]) HSP 1 Score: 178.3 bits (451), Expect = 5.9e-42 Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 1
BLAST of Csa1G012090 vs. NCBI nr
Match: gi|659106081|ref|XP_008453246.1| (PREDICTED: LYR motif-containing protein 4 [Cucumis melo]) HSP 1 Score: 163.7 bits (413), Expect = 1.5e-37 Identity = 82/90 (91.11%), Postives = 85/90 (94.44%), Query Frame = 1
BLAST of Csa1G012090 vs. NCBI nr
Match: gi|695022304|ref|XP_009398276.1| (PREDICTED: LYR motif-containing protein 4-like [Musa acuminata subsp. malaccensis]) HSP 1 Score: 127.5 bits (319), Expect = 1.2e-26 Identity = 61/85 (71.76%), Postives = 74/85 (87.06%), Query Frame = 1
BLAST of Csa1G012090 vs. NCBI nr
Match: gi|460380605|ref|XP_004236045.1| (PREDICTED: LYR motif-containing protein 4 [Solanum lycopersicum]) HSP 1 Score: 126.7 bits (317), Expect = 2.0e-26 Identity = 57/88 (64.77%), Postives = 75/88 (85.23%), Query Frame = 1
BLAST of Csa1G012090 vs. NCBI nr
Match: gi|697139318|ref|XP_009623746.1| (PREDICTED: LYR motif-containing protein 4 [Nicotiana tomentosiformis]) HSP 1 Score: 125.9 bits (315), Expect = 3.5e-26 Identity = 57/85 (67.06%), Postives = 73/85 (85.88%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|