CsGy6G008500 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGAGTGGAGAAAGAAGCCAAGAGAGTTTCAAGGATGTTCCAAAGGGTTGTTTGGCAATCAAAGTTGGCCATGAAAGTGAAGAGAAGCAAAGATTTGTAGTGCCTGTCTTGTATTTCAATCATCCTTTGTTCATTCAACTCCTTAAGGAAGCTGAGGATGAATATGGATTTGATCAAAAGGGAACCATCACTATTCCTTGTCATGTGGAACAATTTAGGTATGTTCAAGCCTTGATCGATCGAGAAACCTCATTTCATCATAATCATCACCATCTCTACGTCCCTTGTTTTAGGGCTTGA ATGGGGAGTGGAGAAAGAAGCCAAGAGAGTTTCAAGGATGTTCCAAAGGGTTGTTTGGCAATCAAAGTTGGCCATGAAAGTGAAGAGAAGCAAAGATTTGTAGTGCCTGTCTTGTATTTCAATCATCCTTTGTTCATTCAACTCCTTAAGGAAGCTGAGGATGAATATGGATTTGATCAAAAGGGAACCATCACTATTCCTTGTCATGTGGAACAATTTAGGTATGTTCAAGCCTTGATCGATCGAGAAACCTCATTTCATCATAATCATCACCATCTCTACGTCCCTTGTTTTAGGGCTTGA ATGGGGAGTGGAGAAAGAAGCCAAGAGAGTTTCAAGGATGTTCCAAAGGGTTGTTTGGCAATCAAAGTTGGCCATGAAAGTGAAGAGAAGCAAAGATTTGTAGTGCCTGTCTTGTATTTCAATCATCCTTTGTTCATTCAACTCCTTAAGGAAGCTGAGGATGAATATGGATTTGATCAAAAGGGAACCATCACTATTCCTTGTCATGTGGAACAATTTAGGTATGTTCAAGCCTTGATCGATCGAGAAACCTCATTTCATCATAATCATCACCATCTCTACGTCCCTTGTTTTAGGGCTTGA MGSGERSQESFKDVPKGCLAIKVGHESEEKQRFVVPVLYFNHPLFIQLLKEAEDEYGFDQKGTITIPCHVEQFRYVQALIDRETSFHHNHHHLYVPCFRA
BLAST of CsGy6G008500 vs. NCBI nr
Match: XP_011656853.1 (PREDICTED: auxin-induced protein X15 [Cucumis sativus] >KGN46526.1 hypothetical protein Csa_6G106780 [Cucumis sativus]) HSP 1 Score: 214.9 bits (546), Expect = 1.2e-52 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of CsGy6G008500 vs. NCBI nr
Match: ADN34225.1 (auxin-responsive family protein [Cucumis melo subsp. melo]) HSP 1 Score: 183.7 bits (465), Expect = 3.0e-43 Identity = 91/100 (91.00%), Postives = 91/100 (91.00%), Query Frame = 0
BLAST of CsGy6G008500 vs. NCBI nr
Match: XP_008459757.1 (PREDICTED: auxin-responsive protein SAUR32 [Cucumis melo]) HSP 1 Score: 181.0 bits (458), Expect = 2.0e-42 Identity = 90/100 (90.00%), Postives = 90/100 (90.00%), Query Frame = 0
BLAST of CsGy6G008500 vs. NCBI nr
Match: XP_023005102.1 (auxin-responsive protein SAUR32-like [Cucurbita maxima]) HSP 1 Score: 157.9 bits (398), Expect = 1.8e-35 Identity = 80/101 (79.21%), Postives = 86/101 (85.15%), Query Frame = 0
BLAST of CsGy6G008500 vs. NCBI nr
Match: KFK37448.1 (hypothetical protein AALP_AA4G258100 [Arabis alpina]) HSP 1 Score: 156.4 bits (394), Expect = 5.2e-35 Identity = 78/116 (67.24%), Postives = 90/116 (77.59%), Query Frame = 0
BLAST of CsGy6G008500 vs. TAIR10
Match: AT2G46690.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 152.1 bits (383), Expect = 1.8e-37 Identity = 79/122 (64.75%), Postives = 91/122 (74.59%), Query Frame = 0
BLAST of CsGy6G008500 vs. TAIR10
Match: AT3G61900.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 137.1 bits (344), Expect = 5.9e-33 Identity = 67/101 (66.34%), Postives = 76/101 (75.25%), Query Frame = 0
BLAST of CsGy6G008500 vs. TAIR10
Match: AT4G00880.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 125.2 bits (313), Expect = 2.3e-29 Identity = 56/78 (71.79%), Postives = 68/78 (87.18%), Query Frame = 0
BLAST of CsGy6G008500 vs. TAIR10
Match: AT5G53590.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 101.3 bits (251), Expect = 3.6e-22 Identity = 45/73 (61.64%), Postives = 58/73 (79.45%), Query Frame = 0
BLAST of CsGy6G008500 vs. TAIR10
Match: AT3G60690.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 84.7 bits (208), Expect = 3.5e-17 Identity = 39/82 (47.56%), Postives = 55/82 (67.07%), Query Frame = 0
BLAST of CsGy6G008500 vs. Swiss-Prot
Match: sp|Q9ZUZ3|SAU32_ARATH (Auxin-responsive protein SAUR32 OS=Arabidopsis thaliana OX=3702 GN=SAUR32 PE=2 SV=1) HSP 1 Score: 152.1 bits (383), Expect = 3.2e-36 Identity = 79/122 (64.75%), Postives = 91/122 (74.59%), Query Frame = 0
BLAST of CsGy6G008500 vs. Swiss-Prot
Match: sp|O22150|SAU36_ARATH (Auxin-responsive protein SAUR36 OS=Arabidopsis thaliana OX=3702 GN=SAUR36 PE=2 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.3e-13 Identity = 36/67 (53.73%), Postives = 46/67 (68.66%), Query Frame = 0
BLAST of CsGy6G008500 vs. Swiss-Prot
Match: sp|Q41220|SAU15_ARATH (Auxin-responsive protein SAUR15 OS=Arabidopsis thaliana OX=3702 GN=SAUR15 PE=2 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 7.1e-12 Identity = 33/81 (40.74%), Postives = 51/81 (62.96%), Query Frame = 0
BLAST of CsGy6G008500 vs. Swiss-Prot
Match: sp|Q9SGU2|SAU71_ARATH (Auxin-responsive protein SAUR71 OS=Arabidopsis thaliana OX=3702 GN=SAUR71 PE=2 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 7.9e-11 Identity = 33/74 (44.59%), Postives = 46/74 (62.16%), Query Frame = 0
BLAST of CsGy6G008500 vs. Swiss-Prot
Match: sp|P32295|ARG7_VIGRR (Indole-3-acetic acid-induced protein ARG7 OS=Vigna radiata var. radiata OX=3916 GN=ARG7 PE=2 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.8e-10 Identity = 34/81 (41.98%), Postives = 52/81 (64.20%), Query Frame = 0
BLAST of CsGy6G008500 vs. TrEMBL
Match: tr|A0A0A0KFM7|A0A0A0KFM7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G106780 PE=4 SV=1) HSP 1 Score: 214.9 bits (546), Expect = 8.1e-53 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of CsGy6G008500 vs. TrEMBL
Match: tr|E5GCM6|E5GCM6_CUCME (Auxin-responsive family protein OS=Cucumis melo subsp. melo OX=412675 PE=4 SV=1) HSP 1 Score: 183.7 bits (465), Expect = 2.0e-43 Identity = 91/100 (91.00%), Postives = 91/100 (91.00%), Query Frame = 0
BLAST of CsGy6G008500 vs. TrEMBL
Match: tr|A0A1S3CBD9|A0A1S3CBD9_CUCME (auxin-responsive protein SAUR32 OS=Cucumis melo OX=3656 GN=LOC103498796 PE=4 SV=1) HSP 1 Score: 181.0 bits (458), Expect = 1.3e-42 Identity = 90/100 (90.00%), Postives = 90/100 (90.00%), Query Frame = 0
BLAST of CsGy6G008500 vs. TrEMBL
Match: tr|A0A087H5P6|A0A087H5P6_ARAAL (Uncharacterized protein OS=Arabis alpina OX=50452 GN=AALP_AA4G258100 PE=4 SV=1) HSP 1 Score: 156.4 bits (394), Expect = 3.4e-35 Identity = 78/116 (67.24%), Postives = 90/116 (77.59%), Query Frame = 0
BLAST of CsGy6G008500 vs. TrEMBL
Match: tr|D7LF78|D7LF78_ARALL (Auxin-responsive family protein OS=Arabidopsis lyrata subsp. lyrata OX=81972 GN=ARALYDRAFT_904140 PE=4 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 2.9e-34 Identity = 81/122 (66.39%), Postives = 90/122 (73.77%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|