CsGy5G018820 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: five_prime_UTRexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.CTTTTACACCCATATTACATTTAAAAACACCTAACCTGCAATTCATCCAAATCCAACATTACATTACATTACACACACACAAAATAAAATATATGGGACACCCAAAATTATGGGGATCATTATTATTGGTAGTTTGTTGTTTGTCACTCGTGAAGAGTGGATTCGGGTTCGCTTGCAATTGGGGGACACGATCGAGTCATCCACTCCCACCCGATATTGTGGTTAAATTGATGAAGGACAATGGGTTCAATAAAGTTAAGCTATTTGAAGCCGATCCAGGTGCGCTTCAGGCTCTTGGCAATTCTGGTCTTCAAGTTATGCTTGGAATTCCTAATGAGTTCTTAGCACCCCTTGCTAGTAGTGTACGTGTTGCGGAGAATTGGGTCGCAAAAAATGTTTCTTATTTCATTTCTAATTTTGGTACCAATATCAGGTAATAATTCGATGATTCGTTTTTTTAATTATTATTTTTTATAAAAGTAATTGA CTTTTACACCCATATTACATTTAAAAACACCTAACCTGCAATTCATCCAAATCCAACATTACATTACATTACACACACACAAAATAAAATATATGGGACACCCAAAATTATGGGGATCATTATTATTGGTAGTTTGTTGTTTGTCACTCGTGAAGAGTGGATTCGGGTTCGCTTGCAATTGGGGGACACGATCGAGTCATCCACTCCCACCCGATATTGTGGTTAAATTGATGAAGGACAATGGGTTCAATAAAGTTAAGCTATTTGAAGCCGATCCAGGTGCGCTTCAGGCTCTTGGCAATTCTGGTCTTCAAGTTATGCTTGGAATTCCTAATGAGTTCTTAGCACCCCTTGCTAGTAGTGTACGTGTTGCGGAGAATTGGGTCGCAAAAAATGTTTCTTATTTCATTTCTAATTTTGGTACCAATATCAGTAATTGA ATGGGACACCCAAAATTATGGGGATCATTATTATTGGTAGTTTGTTGTTTGTCACTCGTGAAGAGTGGATTCGGGTTCGCTTGCAATTGGGGGACACGATCGAGTCATCCACTCCCACCCGATATTGTGGTTAAATTGATGAAGGACAATGGGTTCAATAAAGTTAAGCTATTTGAAGCCGATCCAGGTGCGCTTCAGGCTCTTGGCAATTCTGGTCTTCAAGTTATGCTTGGAATTCCTAATGAGTTCTTAGCACCCCTTGCTAGTAGTGTACGTGTTGCGGAGAATTGGGTCGCAAAAAATGTTTCTTATTTCATTTCTAATTTTGGTACCAATATCAGTAATTGA MGHPKLWGSLLLVVCCLSLVKSGFGFACNWGTRSSHPLPPDIVVKLMKDNGFNKVKLFEADPGALQALGNSGLQVMLGIPNEFLAPLASSVRVAENWVAKNVSYFISNFGTNISN
BLAST of CsGy5G018820 vs. NCBI nr
Match: XP_004150617.1 (PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Cucumis sativus] >XP_011655450.1 PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Cucumis sativus] >XP_011655451.1 PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Cucumis sativus] >KGN51470.1 hypothetical protein Csa_5G561790 [Cucumis sativus]) HSP 1 Score: 238.4 bits (607), Expect = 1.2e-59 Identity = 113/113 (100.00%), Postives = 113/113 (100.00%), Query Frame = 0
BLAST of CsGy5G018820 vs. NCBI nr
Match: XP_008467025.1 (PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Cucumis melo] >ADN33707.1 glucan endo-13-beta-glucosidase precursor [Cucumis melo subsp. melo]) HSP 1 Score: 221.5 bits (563), Expect = 1.5e-54 Identity = 105/113 (92.92%), Postives = 107/113 (94.69%), Query Frame = 0
BLAST of CsGy5G018820 vs. NCBI nr
Match: XP_022146364.1 (glucan endo-1,3-beta-glucosidase 5-like [Momordica charantia]) HSP 1 Score: 194.5 bits (493), Expect = 2.0e-46 Identity = 94/117 (80.34%), Postives = 103/117 (88.03%), Query Frame = 0
BLAST of CsGy5G018820 vs. NCBI nr
Match: XP_022953659.1 (glucan endo-1,3-beta-glucosidase 5-like [Cucurbita moschata]) HSP 1 Score: 194.1 bits (492), Expect = 2.6e-46 Identity = 96/116 (82.76%), Postives = 102/116 (87.93%), Query Frame = 0
BLAST of CsGy5G018820 vs. NCBI nr
Match: XP_023540642.1 (glucan endo-1,3-beta-glucosidase 6-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 194.1 bits (492), Expect = 2.6e-46 Identity = 96/116 (82.76%), Postives = 102/116 (87.93%), Query Frame = 0
BLAST of CsGy5G018820 vs. TAIR10
Match: AT5G20870.1 (O-Glycosyl hydrolases family 17 protein) HSP 1 Score: 145.6 bits (366), Expect = 1.9e-35 Identity = 69/108 (63.89%), Postives = 89/108 (82.41%), Query Frame = 0
BLAST of CsGy5G018820 vs. TAIR10
Match: AT5G58090.1 (O-Glycosyl hydrolases family 17 protein) HSP 1 Score: 129.8 bits (325), Expect = 1.1e-30 Identity = 60/107 (56.07%), Postives = 79/107 (73.83%), Query Frame = 0
BLAST of CsGy5G018820 vs. TAIR10
Match: AT4G31140.1 (O-Glycosyl hydrolases family 17 protein) HSP 1 Score: 112.5 bits (280), Expect = 1.8e-25 Identity = 50/89 (56.18%), Postives = 67/89 (75.28%), Query Frame = 0
BLAST of CsGy5G018820 vs. TAIR10
Match: AT5G64790.1 (O-Glycosyl hydrolases family 17 protein) HSP 1 Score: 100.9 bits (250), Expect = 5.4e-22 Identity = 48/106 (45.28%), Postives = 71/106 (66.98%), Query Frame = 0
BLAST of CsGy5G018820 vs. TAIR10
Match: AT3G24330.1 (O-Glycosyl hydrolases family 17 protein) HSP 1 Score: 95.9 bits (237), Expect = 1.7e-20 Identity = 47/103 (45.63%), Postives = 64/103 (62.14%), Query Frame = 0
BLAST of CsGy5G018820 vs. Swiss-Prot
Match: sp|Q93Z08|E136_ARATH (Glucan endo-1,3-beta-glucosidase 6 OS=Arabidopsis thaliana OX=3702 GN=At5g58090 PE=2 SV=2) HSP 1 Score: 129.8 bits (325), Expect = 1.9e-29 Identity = 60/107 (56.07%), Postives = 79/107 (73.83%), Query Frame = 0
BLAST of CsGy5G018820 vs. Swiss-Prot
Match: sp|Q9M088|E135_ARATH (Glucan endo-1,3-beta-glucosidase 5 OS=Arabidopsis thaliana OX=3702 GN=At4g31140 PE=2 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 3.2e-24 Identity = 50/89 (56.18%), Postives = 67/89 (75.28%), Query Frame = 0
BLAST of CsGy5G018820 vs. Swiss-Prot
Match: sp|Q9FGH4|E139_ARATH (Glucan endo-1,3-beta-glucosidase 9 OS=Arabidopsis thaliana OX=3702 GN=At5g58480 PE=2 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 6.9e-19 Identity = 50/104 (48.08%), Postives = 66/104 (63.46%), Query Frame = 0
BLAST of CsGy5G018820 vs. Swiss-Prot
Match: sp|Q6NKW9|E138_ARATH (Glucan endo-1,3-beta-glucosidase 8 OS=Arabidopsis thaliana OX=3702 GN=At1g64760 PE=2 SV=2) HSP 1 Score: 92.0 bits (227), Expect = 4.5e-18 Identity = 47/104 (45.19%), Postives = 70/104 (67.31%), Query Frame = 0
BLAST of CsGy5G018820 vs. Swiss-Prot
Match: sp|Q9FHX5|E1310_ARATH (Glucan endo-1,3-beta-glucosidase 10 OS=Arabidopsis thaliana OX=3702 GN=At5g42100 PE=2 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 2.4e-11 Identity = 36/103 (34.95%), Postives = 61/103 (59.22%), Query Frame = 0
BLAST of CsGy5G018820 vs. TrEMBL
Match: tr|A0A0A0KPC5|A0A0A0KPC5_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G561790 PE=3 SV=1) HSP 1 Score: 238.4 bits (607), Expect = 7.9e-60 Identity = 113/113 (100.00%), Postives = 113/113 (100.00%), Query Frame = 0
BLAST of CsGy5G018820 vs. TrEMBL
Match: tr|A0A1S3CTV6|A0A1S3CTV6_CUCME (glucan endo-1,3-beta-glucosidase 6 OS=Cucumis melo OX=3656 GN=LOC103504444 PE=3 SV=1) HSP 1 Score: 221.5 bits (563), Expect = 9.9e-55 Identity = 105/113 (92.92%), Postives = 107/113 (94.69%), Query Frame = 0
BLAST of CsGy5G018820 vs. TrEMBL
Match: tr|E5GB65|E5GB65_CUCME (Glucan endo-13-beta-glucosidase OS=Cucumis melo subsp. melo OX=412675 PE=3 SV=1) HSP 1 Score: 221.5 bits (563), Expect = 9.9e-55 Identity = 105/113 (92.92%), Postives = 107/113 (94.69%), Query Frame = 0
BLAST of CsGy5G018820 vs. TrEMBL
Match: tr|E5GCF6|E5GCF6_CUCME (Glucan endo-13-beta-glucosidase (Fragment) OS=Cucumis melo subsp. melo OX=412675 PE=3 SV=1) HSP 1 Score: 186.4 bits (472), Expect = 3.5e-44 Identity = 88/91 (96.70%), Postives = 90/91 (98.90%), Query Frame = 0
BLAST of CsGy5G018820 vs. TrEMBL
Match: tr|A0A2I4EXE6|A0A2I4EXE6_9ROSI (glucan endo-1,3-beta-glucosidase 5-like OS=Juglans regia OX=51240 GN=LOC108993562 PE=3 SV=1) HSP 1 Score: 162.2 bits (409), Expect = 7.2e-37 Identity = 75/94 (79.79%), Postives = 85/94 (90.43%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |