CsGy3G018520 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCCATGTTTCTTGCTGGTTTAGAGGATGAGACATCAGTGAGGGTTAAGCCTTTGGAGAAGGACATGTGTGGGAGAAGTAGACTTGCGTTCTTTATAGGGGTTGCTACTGTTGTTACTAAGTTGTTCAATACTGTGGAACTCGATGTTGCAGTGTTTGGAAAGAAGGATTATCAGGCGGATGGTGAGTCTTTGTAAGAATGTGAATGATTTTGATTTTCATACTTGTTTTGTGCTCAAAATTCATTGTTATTCATTTGAATTCCTAGCTTGATAACTTAATTCTATTATTTATGAATTTAATTTGCATCACTCTAGCCGGGGGCACCAATTAATTTTGAAAGAAGCCTCATGCTATCTAATATGGTATCAAATCCTTAAACTAAAATGAATATTCAACTCATTAAAAAAATTAAATTTTGATCCAATAATAGTGAATCCAAAAGGGTACTATCTTGAAAATGGTCCATAAAATAGTGCATAAATGAAGAAACAAATAAGAGATGAATCAAATGTCCATGTTTTCTCCATAGATTTTTTTCCTCATTTTTATTGCTTATATGTTACTTATGTATACCAGGTAGGAAATTTGGCTGCTCTAGTTGAAGATTGGACAACTAGTGGAAAGCAAGTATCAAACAACGCTTGA ATGTCCATGTTTCTTGCTGGTTTAGAGGATGAGACATCAGTGAGGGTTAAGCCTTTGGAGAAGGACATGTGTGGGAGAAGTAGACTTGCGTTCTTTATAGGGGTTGCTACTGTTGTTACTAAGTTGTTCAATACTGTGGAACTCGATGTTGCAGTGTTTGGAAAGAAGGATTATCAGGCGGATGGAAATTTGGCTGCTCTAGTTGAAGATTGGACAACTAGTGGAAAGCAAGTATCAAACAACGCTTGA ATGTCCATGTTTCTTGCTGGTTTAGAGGATGAGACATCAGTGAGGGTTAAGCCTTTGGAGAAGGACATGTGTGGGAGAAGTAGACTTGCGTTCTTTATAGGGGTTGCTACTGTTGTTACTAAGTTGTTCAATACTGTGGAACTCGATGTTGCAGTGTTTGGAAAGAAGGATTATCAGGCGGATGGAAATTTGGCTGCTCTAGTTGAAGATTGGACAACTAGTGGAAAGCAAGTATCAAACAACGCTTGA MSMFLAGLEDETSVRVKPLEKDMCGRSRLAFFIGVATVVTKLFNTVELDVAVFGKKDYQADGNLAALVEDWTTSGKQVSNNA
BLAST of CsGy3G018520 vs. NCBI nr
Match: KGN43706.1 (hypothetical protein Csa_7G061730 [Cucumis sativus]) HSP 1 Score: 90.5 bits (223), Expect = 2.9e-15 Identity = 46/54 (85.19%), Postives = 47/54 (87.04%), Query Frame = 0
BLAST of CsGy3G018520 vs. NCBI nr
Match: XP_022996300.1 (pantoate--beta-alanine ligase-like [Cucurbita maxima]) HSP 1 Score: 82.4 bits (202), Expect = 7.8e-13 Identity = 43/65 (66.15%), Postives = 48/65 (73.85%), Query Frame = 0
BLAST of CsGy3G018520 vs. NCBI nr
Match: XP_022931128.1 (pantoate--beta-alanine ligase-like [Cucurbita moschata]) HSP 1 Score: 82.0 bits (201), Expect = 1.0e-12 Identity = 43/65 (66.15%), Postives = 48/65 (73.85%), Query Frame = 0
BLAST of CsGy3G018520 vs. NCBI nr
Match: XP_022849488.1 (pantoate--beta-alanine ligase isoform X1 [Olea europaea var. sylvestris]) HSP 1 Score: 80.9 bits (198), Expect = 2.3e-12 Identity = 41/64 (64.06%), Postives = 48/64 (75.00%), Query Frame = 0
BLAST of CsGy3G018520 vs. NCBI nr
Match: XP_022849489.1 (pantoate--beta-alanine ligase isoform X2 [Olea europaea var. sylvestris]) HSP 1 Score: 80.9 bits (198), Expect = 2.3e-12 Identity = 41/64 (64.06%), Postives = 48/64 (75.00%), Query Frame = 0
BLAST of CsGy3G018520 vs. TAIR10
Match: AT5G48840.1 (homolog of bacterial PANC) HSP 1 Score: 76.6 bits (187), Expect = 7.7e-15 Identity = 39/64 (60.94%), Postives = 46/64 (71.88%), Query Frame = 0
BLAST of CsGy3G018520 vs. Swiss-Prot
Match: sp|O24035|PANC_LOTJA (Pantoate--beta-alanine ligase OS=Lotus japonicus OX=34305 GN=PANC PE=1 SV=3) HSP 1 Score: 77.0 bits (188), Expect = 1.1e-13 Identity = 41/75 (54.67%), Postives = 50/75 (66.67%), Query Frame = 0
BLAST of CsGy3G018520 vs. Swiss-Prot
Match: sp|Q9FKB3|PANC_ARATH (Pantoate--beta-alanine ligase OS=Arabidopsis thaliana OX=3702 GN=At5g48840 PE=1 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.4e-13 Identity = 39/64 (60.94%), Postives = 46/64 (71.88%), Query Frame = 0
BLAST of CsGy3G018520 vs. Swiss-Prot
Match: sp|O24210|PANC_ORYSJ (Pantoate--beta-alanine ligase OS=Oryza sativa subsp. japonica OX=39947 GN=PANC PE=2 SV=2) HSP 1 Score: 75.9 bits (185), Expect = 2.4e-13 Identity = 40/65 (61.54%), Postives = 46/65 (70.77%), Query Frame = 0
BLAST of CsGy3G018520 vs. Swiss-Prot
Match: sp|A4XYC5|PANC_PSEMY (Pantothenate synthetase OS=Pseudomonas mendocina (strain ymp) OX=399739 GN=panC PE=3 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 7.7e-12 Identity = 36/68 (52.94%), Postives = 47/68 (69.12%), Query Frame = 0
BLAST of CsGy3G018520 vs. Swiss-Prot
Match: sp|Q4K5Y3|PANC_PSEF5 (Pantothenate synthetase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=panC PE=3 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 6.5e-11 Identity = 35/68 (51.47%), Postives = 45/68 (66.18%), Query Frame = 0
BLAST of CsGy3G018520 vs. TrEMBL
Match: tr|A0A0A0K7A9|A0A0A0K7A9_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G061730 PE=4 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.9e-15 Identity = 46/54 (85.19%), Postives = 47/54 (87.04%), Query Frame = 0
BLAST of CsGy3G018520 vs. TrEMBL
Match: tr|A0A2P4JMU1|A0A2P4JMU1_QUESU (Pantoate--beta-alanine ligase OS=Quercus suber OX=58331 GN=CFP56_41846 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 2.0e-12 Identity = 43/64 (67.19%), Postives = 47/64 (73.44%), Query Frame = 0
BLAST of CsGy3G018520 vs. TrEMBL
Match: tr|A0A2I4EQE2|A0A2I4EQE2_9ROSI (pantoate--beta-alanine ligase OS=Juglans regia OX=51240 GN=LOC108991706 PE=3 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 3.3e-12 Identity = 43/64 (67.19%), Postives = 47/64 (73.44%), Query Frame = 0
BLAST of CsGy3G018520 vs. TrEMBL
Match: tr|A0A164Z4E3|A0A164Z4E3_DAUCA (Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_018553 PE=3 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 4.4e-12 Identity = 43/75 (57.33%), Postives = 52/75 (69.33%), Query Frame = 0
BLAST of CsGy3G018520 vs. TrEMBL
Match: tr|A0A1J3IQV3|A0A1J3IQV3_NOCCA (Pantoate--beta-alanine ligase (Fragment) OS=Noccaea caerulescens OX=107243 GN=MP_TR8862_c0_g1_i1_g.27667 PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 5.7e-12 Identity = 41/64 (64.06%), Postives = 47/64 (73.44%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|