CsGy2G001360 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCCCTCGCATACGCCGTCGCTCACTCTTCTCAGTCAACGCAACTCCGCATCAGAAACCGCCGGAAAACCAGTTTTCGAAAGCGATGCTTCCGGATGATCAAGCAACAGAAAACCAGATTTTATATCCTCGGCCGTTGCATCTCCATGCTTCTTTGTTGGCACGATCATGATATTACTGATTAA ATGTCCCTCGCATACGCCGTCGCTCACTCTTCTCAGTCAACGCAACTCCGCATCAGAAACCGCCGGAAAACCAGTTTTCGAAAGCGATGCTTCCGGATGATCAAGCAACAGAAAACCAGATTTTATATCCTCGGCCGTTGCATCTCCATGCTTCTTTGTTGGCACGATCATGATATTACTGATTAA ATGTCCCTCGCATACGCCGTCGCTCACTCTTCTCAGTCAACGCAACTCCGCATCAGAAACCGCCGGAAAACCAGTTTTCGAAAGCGATGCTTCCGGATGATCAAGCAACAGAAAACCAGATTTTATATCCTCGGCCGTTGCATCTCCATGCTTCTTTGTTGGCACGATCATGATATTACTGATTAA MSLAYAVAHSSQSTQLRIRNRRKTSFRKRCFRMIKQQKTRFYILGRCISMLLCWHDHDITD
BLAST of CsGy2G001360 vs. NCBI nr
Match: KGN60637.1 (hypothetical protein Csa_2G005340 [Cucumis sativus]) HSP 1 Score: 125.9 bits (315), Expect = 4.6e-26 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of CsGy2G001360 vs. NCBI nr
Match: XP_024029977.1 (uncharacterized protein LOC112094100 [Morus notabilis]) HSP 1 Score: 79.7 bits (195), Expect = 3.7e-12 Identity = 39/60 (65.00%), Postives = 44/60 (73.33%), Query Frame = 0
BLAST of CsGy2G001360 vs. NCBI nr
Match: PKU67116.1 (hypothetical protein MA16_Dca012977 [Dendrobium catenatum]) HSP 1 Score: 78.2 bits (191), Expect = 1.1e-11 Identity = 37/61 (60.66%), Postives = 46/61 (75.41%), Query Frame = 0
BLAST of CsGy2G001360 vs. NCBI nr
Match: XP_021903113.1 (uncharacterized protein LOC110818516 [Carica papaya]) HSP 1 Score: 77.4 bits (189), Expect = 1.9e-11 Identity = 34/40 (85.00%), Postives = 35/40 (87.50%), Query Frame = 0
BLAST of CsGy2G001360 vs. NCBI nr
Match: PSS20885.1 (Lipoyl synthase [Actinidia chinensis var. chinensis]) HSP 1 Score: 77.0 bits (188), Expect = 2.4e-11 Identity = 32/54 (59.26%), Postives = 43/54 (79.63%), Query Frame = 0
BLAST of CsGy2G001360 vs. TAIR10
Match: AT4G13395.1 (ROTUNDIFOLIA like 12) HSP 1 Score: 64.3 bits (155), Expect = 3.0e-11 Identity = 29/49 (59.18%), Postives = 35/49 (71.43%), Query Frame = 0
BLAST of CsGy2G001360 vs. TAIR10
Match: AT2G36985.1 (DVL family protein) HSP 1 Score: 49.3 bits (116), Expect = 9.8e-07 Identity = 20/39 (51.28%), Postives = 30/39 (76.92%), Query Frame = 0
BLAST of CsGy2G001360 vs. TAIR10
Match: AT3G55515.1 (ROTUNDIFOLIA like 7) HSP 1 Score: 48.9 bits (115), Expect = 1.3e-06 Identity = 19/46 (41.30%), Postives = 33/46 (71.74%), Query Frame = 0
BLAST of CsGy2G001360 vs. TAIR10
Match: AT2G39705.1 (ROTUNDIFOLIA like 8) HSP 1 Score: 48.5 bits (114), Expect = 1.7e-06 Identity = 18/48 (37.50%), Postives = 34/48 (70.83%), Query Frame = 0
BLAST of CsGy2G001360 vs. TAIR10
Match: AT3G46613.1 (ROTUNDIFOLIA like 4) HSP 1 Score: 47.4 bits (111), Expect = 3.7e-06 Identity = 16/29 (55.17%), Postives = 24/29 (82.76%), Query Frame = 0
BLAST of CsGy2G001360 vs. TrEMBL
Match: tr|A0A0A0LIV1|A0A0A0LIV1_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G005340 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 3.0e-26 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of CsGy2G001360 vs. TrEMBL
Match: tr|A0A2I0VUM3|A0A2I0VUM3_9ASPA (Uncharacterized protein OS=Dendrobium catenatum OX=906689 GN=MA16_Dca012977 PE=4 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 7.2e-12 Identity = 37/61 (60.66%), Postives = 46/61 (75.41%), Query Frame = 0
BLAST of CsGy2G001360 vs. TrEMBL
Match: tr|A0A2R6R4H0|A0A2R6R4H0_ACTCH (Lipoyl synthase OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc09924 PE=4 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.6e-11 Identity = 32/54 (59.26%), Postives = 43/54 (79.63%), Query Frame = 0
BLAST of CsGy2G001360 vs. TrEMBL
Match: tr|A0A2P6RJL2|A0A2P6RJL2_ROSCH (Uncharacterized protein OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr2g0091061 PE=4 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 6.1e-11 Identity = 37/58 (63.79%), Postives = 44/58 (75.86%), Query Frame = 0
BLAST of CsGy2G001360 vs. TrEMBL
Match: tr|A0A251NFG1|A0A251NFG1_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_7G227100 PE=4 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 8.0e-11 Identity = 33/47 (70.21%), Postives = 38/47 (80.85%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |