CsGy1G026310 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAAAGTTAGGAGCAATCTTCAGTTGGGTCTTTGTTGCCTTCCTTGTTCTATATGCAGGTTTAACTTAATTCTCTCTTCTCAATGTATTAACCTTCAAATTACTGTTTTTTTTGGTTCAAAGGTAAACTTAATCATCTTTATATCATCGTGTCTAACAACGATAGAGTACGTGTACAATTGGAATTGCAGGGAGTATGAATACAAATGCACAGTTGTGCTGCAACAATCATCGTGAGTTGGGATCATGCGTGCCAGGAGTAGACGATGATTATGATGGGAAGTGTTGGCATCATTGCATTGTTGGTTGTGAGAGAGGTGGATTTTGTAAAAAACTTTGGTATGGACAT ATGGCAAAGTTAGGAGCAATCTTCAGTTGGGTCTTTGTTGCCTTCCTTGTTCTATATGCAGGGAGTATGAATACAAATGCACAGTTGTGCTGCAACAATCATCGTGAGTTGGGATCATGCGTGCCAGGAGTAGACGATGATTATGATGGGAAGTGTTGGCATCATTGCATTGTTGGTTGTGAGAGAGGTGGATTTTGTAAAAAACTTTGGTATGGACAT ATGGCAAAGTTAGGAGCAATCTTCAGTTGGGTCTTTGTTGCCTTCCTTGTTCTATATGCAGGGAGTATGAATACAAATGCACAGTTGTGCTGCAACAATCATCGTGAGTTGGGATCATGCGTGCCAGGAGTAGACGATGATTATGATGGGAAGTGTTGGCATCATTGCATTGTTGGTTGTGAGAGAGGTGGATTTTGTAAAAAACTTTGGTATGGACAT MAKLGAIFSWVFVAFLVLYAGSMNTNAQLCCNNHRELGSCVPGVDDDYDGKCWHHCIVGCERGGFCKKLWYGH
BLAST of CsGy1G026310 vs. NCBI nr
Match: KGN66133.1 (hypothetical protein Csa_1G573030 [Cucumis sativus]) HSP 1 Score: 169.9 bits (429), Expect = 3.3e-39 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of CsGy1G026310 vs. NCBI nr
Match: KGN66136.1 (hypothetical protein Csa_1G573060 [Cucumis sativus]) HSP 1 Score: 122.5 bits (306), Expect = 6.0e-25 Identity = 54/69 (78.26%), Postives = 57/69 (82.61%), Query Frame = 0
BLAST of CsGy1G026310 vs. NCBI nr
Match: KGN66134.1 (hypothetical protein Csa_1G573040 [Cucumis sativus]) HSP 1 Score: 101.3 bits (251), Expect = 1.4e-18 Identity = 44/73 (60.27%), Postives = 53/73 (72.60%), Query Frame = 0
BLAST of CsGy1G026310 vs. NCBI nr
Match: KGN66137.1 (hypothetical protein Csa_1G573070 [Cucumis sativus]) HSP 1 Score: 89.4 bits (220), Expect = 5.7e-15 Identity = 41/71 (57.75%), Postives = 51/71 (71.83%), Query Frame = 0
BLAST of CsGy1G026310 vs. NCBI nr
Match: KJB28843.1 (hypothetical protein B456_005G072200, partial [Gossypium raimondii]) HSP 1 Score: 76.6 bits (187), Expect = 3.8e-11 Identity = 32/46 (69.57%), Postives = 35/46 (76.09%), Query Frame = 0
BLAST of CsGy1G026310 vs. TAIR10
Match: AT5G52605.1 (Defensin-like (DEFL) family protein) HSP 1 Score: 67.0 bits (162), Expect = 5.5e-12 Identity = 26/47 (55.32%), Postives = 31/47 (65.96%), Query Frame = 0
BLAST of CsGy1G026310 vs. TAIR10
Match: AT4G14276.1 (Defensin-like (DEFL) family protein) HSP 1 Score: 65.5 bits (158), Expect = 1.6e-11 Identity = 31/81 (38.27%), Postives = 42/81 (51.85%), Query Frame = 0
BLAST of CsGy1G026310 vs. TAIR10
Match: AT4G18823.1 (Defensin-like (DEFL) family protein) HSP 1 Score: 45.1 bits (105), Expect = 2.2e-05 Identity = 26/69 (37.68%), Postives = 31/69 (44.93%), Query Frame = 0
BLAST of CsGy1G026310 vs. Swiss-Prot
Match: sp|Q2V2S1|DEF20_ARATH (Putative defensin-like protein 20 OS=Arabidopsis thaliana OX=3702 GN=At5g52605 PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 9.8e-11 Identity = 26/47 (55.32%), Postives = 31/47 (65.96%), Query Frame = 0
BLAST of CsGy1G026310 vs. Swiss-Prot
Match: sp|P0CAX9|DEF21_ARATH (Defensin-like protein 21 OS=Arabidopsis thaliana OX=3702 GN=At4g14276 PE=2 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 2.9e-10 Identity = 31/81 (38.27%), Postives = 42/81 (51.85%), Query Frame = 0
BLAST of CsGy1G026310 vs. Swiss-Prot
Match: sp|Q2L6T3|DEF27_ARATH (Putative defensin-like protein 27 OS=Arabidopsis thaliana OX=3702 GN=At4g18823 PE=3 SV=1) HSP 1 Score: 45.1 bits (105), Expect = 4.0e-04 Identity = 26/69 (37.68%), Postives = 31/69 (44.93%), Query Frame = 0
BLAST of CsGy1G026310 vs. TrEMBL
Match: tr|A0A0A0LWJ9|A0A0A0LWJ9_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G573030 PE=4 SV=1) HSP 1 Score: 169.9 bits (429), Expect = 2.2e-39 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of CsGy1G026310 vs. TrEMBL
Match: tr|A0A0A0M1N0|A0A0A0M1N0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G573060 PE=4 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 4.0e-25 Identity = 54/69 (78.26%), Postives = 57/69 (82.61%), Query Frame = 0
BLAST of CsGy1G026310 vs. TrEMBL
Match: tr|A0A0A0LYL5|A0A0A0LYL5_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G573040 PE=4 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 9.5e-19 Identity = 44/73 (60.27%), Postives = 53/73 (72.60%), Query Frame = 0
BLAST of CsGy1G026310 vs. TrEMBL
Match: tr|A0A0A0LZ58|A0A0A0LZ58_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G573070 PE=4 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 3.7e-15 Identity = 41/71 (57.75%), Postives = 51/71 (71.83%), Query Frame = 0
BLAST of CsGy1G026310 vs. TrEMBL
Match: tr|A0A0D2RAJ9|A0A0D2RAJ9_GOSRA (Uncharacterized protein OS=Gossypium raimondii OX=29730 GN=B456_005G072300 PE=4 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 2.5e-11 Identity = 32/46 (69.57%), Postives = 35/46 (76.09%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|