Cp4.1LG17g10370 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGAGTAGGGAGAGATCAAGCCAAGGGAGCCCCAAATTAGGTGTCCCAAAGGGGTATTTGGCTATAAAAGTTGGGCATCAGAGTGAAGAAAAGCAAAGATTTGTGGTGCCTGTCTTGTATTTCAATCACCCTTTGTTCATGCAGCTGCTCAAGGAGGCTGAAGAGGAGTATGGCTTTGATCAAAAGGGAACCATCACTATTCCTTGTCATGTGGACCAATTTAAGTATGTTCAAGCCTTGATTGATCAAGAAATCTCCTTCCATTCGCCCCATCTCCACGTTCCGTGCTTTCGGGTTTGA ATGGTGAGTAGGGAGAGATCAAGCCAAGGGAGCCCCAAATTAGGTGTCCCAAAGGGGTATTTGGCTATAAAAGTTGGGCATCAGAGTGAAGAAAAGCAAAGATTTGTGGTGCCTGTCTTGTATTTCAATCACCCTTTGTTCATGCAGCTGCTCAAGGAGGCTGAAGAGGAGTATGGCTTTGATCAAAAGGGAACCATCACTATTCCTTGTCATGTGGACCAATTTAAGTATGTTCAAGCCTTGATTGATCAAGAAATCTCCTTCCATTCGCCCCATCTCCACGTTCCGTGCTTTCGGGTTTGA ATGGTGAGTAGGGAGAGATCAAGCCAAGGGAGCCCCAAATTAGGTGTCCCAAAGGGGTATTTGGCTATAAAAGTTGGGCATCAGAGTGAAGAAAAGCAAAGATTTGTGGTGCCTGTCTTGTATTTCAATCACCCTTTGTTCATGCAGCTGCTCAAGGAGGCTGAAGAGGAGTATGGCTTTGATCAAAAGGGAACCATCACTATTCCTTGTCATGTGGACCAATTTAAGTATGTTCAAGCCTTGATTGATCAAGAAATCTCCTTCCATTCGCCCCATCTCCACGTTCCGTGCTTTCGGGTTTGA MVSRERSSQGSPKLGVPKGYLAIKVGHQSEEKQRFVVPVLYFNHPLFMQLLKEAEEEYGFDQKGTITIPCHVDQFKYVQALIDQEISFHSPHLHVPCFRV
BLAST of Cp4.1LG17g10370 vs. Swiss-Prot
Match: SAU32_ARATH (Auxin-responsive protein SAUR32 OS=Arabidopsis thaliana GN=SAUR32 PE=2 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 6.8e-31 Identity = 62/79 (78.48%), Postives = 71/79 (89.87%), Query Frame = 1
BLAST of Cp4.1LG17g10370 vs. Swiss-Prot
Match: SAU36_ARATH (Auxin-responsive protein SAUR36 OS=Arabidopsis thaliana GN=SAUR36 PE=2 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 2.0e-14 Identity = 36/67 (53.73%), Postives = 49/67 (73.13%), Query Frame = 1
BLAST of Cp4.1LG17g10370 vs. Swiss-Prot
Match: SAU15_ARATH (Auxin-responsive protein SAUR15 OS=Arabidopsis thaliana GN=SAUR15 PE=2 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 3.7e-13 Identity = 37/83 (44.58%), Postives = 53/83 (63.86%), Query Frame = 1
BLAST of Cp4.1LG17g10370 vs. Swiss-Prot
Match: ARG7_VIGRR (Indole-3-acetic acid-induced protein ARG7 OS=Vigna radiata var. radiata GN=ARG7 PE=2 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 8.3e-13 Identity = 36/81 (44.44%), Postives = 51/81 (62.96%), Query Frame = 1
BLAST of Cp4.1LG17g10370 vs. Swiss-Prot
Match: SAU71_ARATH (Auxin-responsive protein SAUR71 OS=Arabidopsis thaliana GN=SAUR71 PE=2 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 2.0e-11 Identity = 32/75 (42.67%), Postives = 50/75 (66.67%), Query Frame = 1
BLAST of Cp4.1LG17g10370 vs. TrEMBL
Match: E5GCM6_CUCME (Auxin-responsive family protein OS=Cucumis melo subsp. melo PE=4 SV=1) HSP 1 Score: 158.3 bits (399), Expect = 4.9e-36 Identity = 79/103 (76.70%), Postives = 87/103 (84.47%), Query Frame = 1
BLAST of Cp4.1LG17g10370 vs. TrEMBL
Match: A0A0A0KFM7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G106780 PE=4 SV=1) HSP 1 Score: 157.1 bits (396), Expect = 1.1e-35 Identity = 78/101 (77.23%), Postives = 86/101 (85.15%), Query Frame = 1
BLAST of Cp4.1LG17g10370 vs. TrEMBL
Match: M5X0E8_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa010986mg PE=4 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 6.2e-31 Identity = 72/102 (70.59%), Postives = 80/102 (78.43%), Query Frame = 1
BLAST of Cp4.1LG17g10370 vs. TrEMBL
Match: A0A0K9RRJ6_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_042280 PE=4 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 8.0e-31 Identity = 73/114 (64.04%), Postives = 85/114 (74.56%), Query Frame = 1
BLAST of Cp4.1LG17g10370 vs. TrEMBL
Match: A0A061DS44_THECC (SAUR-like auxin-responsive protein family OS=Theobroma cacao GN=TCM_005070 PE=4 SV=1) HSP 1 Score: 140.6 bits (353), Expect = 1.1e-30 Identity = 67/85 (78.82%), Postives = 74/85 (87.06%), Query Frame = 1
BLAST of Cp4.1LG17g10370 vs. TAIR10
Match: AT2G46690.1 (AT2G46690.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 134.4 bits (337), Expect = 3.8e-32 Identity = 62/79 (78.48%), Postives = 71/79 (89.87%), Query Frame = 1
BLAST of Cp4.1LG17g10370 vs. TAIR10
Match: AT3G61900.1 (AT3G61900.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 124.4 bits (311), Expect = 3.9e-29 Identity = 57/72 (79.17%), Postives = 65/72 (90.28%), Query Frame = 1
BLAST of Cp4.1LG17g10370 vs. TAIR10
Match: AT4G00880.1 (AT4G00880.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 121.3 bits (303), Expect = 3.3e-28 Identity = 61/96 (63.54%), Postives = 73/96 (76.04%), Query Frame = 1
BLAST of Cp4.1LG17g10370 vs. TAIR10
Match: AT5G53590.1 (AT5G53590.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 99.4 bits (246), Expect = 1.4e-21 Identity = 47/81 (58.02%), Postives = 61/81 (75.31%), Query Frame = 1
BLAST of Cp4.1LG17g10370 vs. TAIR10
Match: AT3G60690.1 (AT3G60690.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 87.8 bits (216), Expect = 4.1e-18 Identity = 39/73 (53.42%), Postives = 52/73 (71.23%), Query Frame = 1
BLAST of Cp4.1LG17g10370 vs. NCBI nr
Match: gi|307136418|gb|ADN34225.1| (auxin-responsive family protein [Cucumis melo subsp. melo]) HSP 1 Score: 158.3 bits (399), Expect = 7.0e-36 Identity = 79/103 (76.70%), Postives = 87/103 (84.47%), Query Frame = 1
BLAST of Cp4.1LG17g10370 vs. NCBI nr
Match: gi|659119628|ref|XP_008459757.1| (PREDICTED: indole-3-acetic acid-induced protein ARG7 [Cucumis melo]) HSP 1 Score: 157.5 bits (397), Expect = 1.2e-35 Identity = 74/88 (84.09%), Postives = 81/88 (92.05%), Query Frame = 1
BLAST of Cp4.1LG17g10370 vs. NCBI nr
Match: gi|778712138|ref|XP_011656853.1| (PREDICTED: auxin-induced protein X15 [Cucumis sativus]) HSP 1 Score: 157.1 bits (396), Expect = 1.6e-35 Identity = 78/101 (77.23%), Postives = 86/101 (85.15%), Query Frame = 1
BLAST of Cp4.1LG17g10370 vs. NCBI nr
Match: gi|1009142561|ref|XP_015888787.1| (PREDICTED: auxin-responsive protein SAUR32-like [Ziziphus jujuba]) HSP 1 Score: 145.6 bits (366), Expect = 4.7e-32 Identity = 69/86 (80.23%), Postives = 74/86 (86.05%), Query Frame = 1
BLAST of Cp4.1LG17g10370 vs. NCBI nr
Match: gi|731311158|ref|XP_010692322.1| (PREDICTED: auxin-induced protein X15 [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 143.7 bits (361), Expect = 1.8e-31 Identity = 66/93 (70.97%), Postives = 80/93 (86.02%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |