Cp4.1LG15g02910 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAAAGGTGAAGAGATTAGCAGCTGAAAATGAAGTGTTGGTAATAAGCAAGAGCTCTTGTTGCCTTTGTTATGCAGTGGTTGTTCTTCTAAGGGACCTTGGAGTTTGCCCCATGGTGTACGAGCTTGATCATGACCCTGAAGCAAGAGATGTGGAGAAGGCTCTTGTAAGGTTGCAAGTCTGCCACGCACCGCCTGTTCCCGCCGTGTTCATCGCCGGAGAACTCATCGGATCGACCAACGAAGTCATGTCGCTTCACCTTAGTGGCGATCTCAATCGAATGTTGAAACCCTACAAGGTGGTTCAAGAGAACTAG ATGGAAAAGGTGAAGAGATTAGCAGCTGAAAATGAAGTGTTGGTAATAAGCAAGAGCTCTTGTTGCCTTTGTTATGCAGTGGTTGTTCTTCTAAGGGACCTTGGAGTTTGCCCCATGGTGTACGAGCTTGATCATGACCCTGAAGCAAGAGATGTGGAGAAGGCTCTTGTAAGGTTGCAAGTCTGCCACGCACCGCCTGTTCCCGCCGTGTTCATCGCCGGAGAACTCATCGGATCGACCAACGAAGTCATGTCGCTTCACCTTAGTGGCGATCTCAATCGAATGTTGAAACCCTACAAGGTGGTTCAAGAGAACTAG ATGGAAAAGGTGAAGAGATTAGCAGCTGAAAATGAAGTGTTGGTAATAAGCAAGAGCTCTTGTTGCCTTTGTTATGCAGTGGTTGTTCTTCTAAGGGACCTTGGAGTTTGCCCCATGGTGTACGAGCTTGATCATGACCCTGAAGCAAGAGATGTGGAGAAGGCTCTTGTAAGGTTGCAAGTCTGCCACGCACCGCCTGTTCCCGCCGTGTTCATCGCCGGAGAACTCATCGGATCGACCAACGAAGTCATGTCGCTTCACCTTAGTGGCGATCTCAATCGAATGTTGAAACCCTACAAGGTGGTTCAAGAGAACTAG MEKVKRLAAENEVLVISKSSCCLCYAVVVLLRDLGVCPMVYELDHDPEARDVEKALVRLQVCHAPPVPAVFIAGELIGSTNEVMSLHLSGDLNRMLKPYKVVQEN
BLAST of Cp4.1LG15g02910 vs. Swiss-Prot
Match: GRC14_ARATH (Glutaredoxin-C14 OS=Arabidopsis thaliana GN=GRXC14 PE=3 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 9.6e-28 Identity = 58/100 (58.00%), Postives = 82/100 (82.00%), Query Frame = 1
BLAST of Cp4.1LG15g02910 vs. Swiss-Prot
Match: GRC13_ARATH (Glutaredoxin-C13 OS=Arabidopsis thaliana GN=GRXC13 PE=3 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 2.8e-27 Identity = 58/102 (56.86%), Postives = 81/102 (79.41%), Query Frame = 1
BLAST of Cp4.1LG15g02910 vs. Swiss-Prot
Match: GRXS9_ARATH (Monothiol glutaredoxin-S9 OS=Arabidopsis thaliana GN=GRXS9 PE=3 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 1.1e-26 Identity = 59/100 (59.00%), Postives = 80/100 (80.00%), Query Frame = 1
BLAST of Cp4.1LG15g02910 vs. Swiss-Prot
Match: GRS11_ARATH (Monothiol glutaredoxin-S11 OS=Arabidopsis thaliana GN=GRXS11 PE=3 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 3.1e-26 Identity = 58/99 (58.59%), Postives = 78/99 (78.79%), Query Frame = 1
BLAST of Cp4.1LG15g02910 vs. Swiss-Prot
Match: GRXC1_ORYSJ (Glutaredoxin-C1 OS=Oryza sativa subsp. japonica GN=GRXC1 PE=3 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 6.0e-22 Identity = 53/97 (54.64%), Postives = 72/97 (74.23%), Query Frame = 1
BLAST of Cp4.1LG15g02910 vs. TrEMBL
Match: A0A0A0K5I6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G230940 PE=4 SV=1) HSP 1 Score: 185.7 bits (470), Expect = 3.0e-44 Identity = 91/105 (86.67%), Postives = 97/105 (92.38%), Query Frame = 1
BLAST of Cp4.1LG15g02910 vs. TrEMBL
Match: A0A059AXS0_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_H01202 PE=4 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 2.1e-29 Identity = 68/100 (68.00%), Postives = 82/100 (82.00%), Query Frame = 1
BLAST of Cp4.1LG15g02910 vs. TrEMBL
Match: A0A166DAH0_DAUCA (Uncharacterized protein OS=Daucus carota subsp. sativus GN=DCAR_005845 PE=4 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 4.6e-29 Identity = 66/105 (62.86%), Postives = 83/105 (79.05%), Query Frame = 1
BLAST of Cp4.1LG15g02910 vs. TrEMBL
Match: A0A0S3SS66_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.08G243600 PE=4 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 6.1e-29 Identity = 67/100 (67.00%), Postives = 83/100 (83.00%), Query Frame = 1
BLAST of Cp4.1LG15g02910 vs. TrEMBL
Match: A0A166HE67_DAUCA (Uncharacterized protein OS=Daucus carota subsp. sativus GN=DCAR_002796 PE=4 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 6.1e-29 Identity = 65/102 (63.73%), Postives = 85/102 (83.33%), Query Frame = 1
BLAST of Cp4.1LG15g02910 vs. TAIR10
Match: AT3G62960.1 (AT3G62960.1 Thioredoxin superfamily protein) HSP 1 Score: 124.0 bits (310), Expect = 5.4e-29 Identity = 58/100 (58.00%), Postives = 82/100 (82.00%), Query Frame = 1
BLAST of Cp4.1LG15g02910 vs. TAIR10
Match: AT2G47880.1 (AT2G47880.1 Glutaredoxin family protein) HSP 1 Score: 122.5 bits (306), Expect = 1.6e-28 Identity = 58/102 (56.86%), Postives = 81/102 (79.41%), Query Frame = 1
BLAST of Cp4.1LG15g02910 vs. TAIR10
Match: AT2G30540.1 (AT2G30540.1 Thioredoxin superfamily protein) HSP 1 Score: 120.6 bits (301), Expect = 6.0e-28 Identity = 59/100 (59.00%), Postives = 80/100 (80.00%), Query Frame = 1
BLAST of Cp4.1LG15g02910 vs. TAIR10
Match: AT1G06830.1 (AT1G06830.1 Glutaredoxin family protein) HSP 1 Score: 119.0 bits (297), Expect = 1.7e-27 Identity = 58/99 (58.59%), Postives = 78/99 (78.79%), Query Frame = 1
BLAST of Cp4.1LG15g02910 vs. TAIR10
Match: AT2G47870.1 (AT2G47870.1 Thioredoxin superfamily protein) HSP 1 Score: 94.7 bits (234), Expect = 3.5e-20 Identity = 43/97 (44.33%), Postives = 67/97 (69.07%), Query Frame = 1
BLAST of Cp4.1LG15g02910 vs. NCBI nr
Match: gi|449444230|ref|XP_004139878.1| (PREDICTED: glutaredoxin-C13-like [Cucumis sativus]) HSP 1 Score: 185.7 bits (470), Expect = 4.3e-44 Identity = 91/105 (86.67%), Postives = 97/105 (92.38%), Query Frame = 1
BLAST of Cp4.1LG15g02910 vs. NCBI nr
Match: gi|702435927|ref|XP_010069984.1| (PREDICTED: glutaredoxin-C13-like [Eucalyptus grandis]) HSP 1 Score: 136.3 bits (342), Expect = 3.0e-29 Identity = 68/100 (68.00%), Postives = 82/100 (82.00%), Query Frame = 1
BLAST of Cp4.1LG15g02910 vs. NCBI nr
Match: gi|1021047228|gb|KZN05008.1| (hypothetical protein DCAR_005845 [Daucus carota subsp. sativus]) HSP 1 Score: 135.2 bits (339), Expect = 6.7e-29 Identity = 66/105 (62.86%), Postives = 83/105 (79.05%), Query Frame = 1
BLAST of Cp4.1LG15g02910 vs. NCBI nr
Match: gi|920691717|gb|KOM34942.1| (hypothetical protein LR48_Vigan02g109200 [Vigna angularis]) HSP 1 Score: 134.8 bits (338), Expect = 8.7e-29 Identity = 67/100 (67.00%), Postives = 83/100 (83.00%), Query Frame = 1
BLAST of Cp4.1LG15g02910 vs. NCBI nr
Match: gi|1021052362|gb|KZN10140.1| (hypothetical protein DCAR_002796 [Daucus carota subsp. sativus]) HSP 1 Score: 134.8 bits (338), Expect = 8.7e-29 Identity = 65/102 (63.73%), Postives = 85/102 (83.33%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|