Cp4.1LG14g07010 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGGGATTACAGGTTCATGGTGGTATAGGATATACAACTGCTACAAGTTTCTTAGTAACCATACATGTTCTCATTGACATTGAAACATTGAATTTGATTGATTGTGCAGACGAAGAAGGATGAGATGTCGATCTTCAAAATGGATCGAATTCCATTCCTTGAAGAACAGGTAAGGAAGGTAAAGGAACAGGGGAAGCTCATAACAATGGACATCGAAAGACTTCTGCTATCAGAGGACAACCGCTTCGATTTTGTGAACGAGGTTGCAGCGGAGGCTAAGGATTACGTGGAGAACAATCGTGATGAATATGGGGGTTCCAAGAAAGCCATTCTTCATGTTCTTAGCAACCGAGTGAACGATGCAGGGTTCTATCGACCGGATGCATATGCAGAAGAGGACCCATTTAAACCCGGACCTCATTATCTCAAACAAGAATTTACTTGA ATGTGGGATTACAGGTTCATGGTGACGAAGAAGGATGAGATGTCGATCTTCAAAATGGATCGAATTCCATTCCTTGAAGAACAGGTAAGGAAGGTAAAGGAACAGGGGAAGCTCATAACAATGGACATCGAAAGACTTCTGCTATCAGAGGACAACCGCTTCGATTTTGTGAACGAGGTTGCAGCGGAGGCTAAGGATTACGTGGAGAACAATCGTGATGAATATGGGGGTTCCAAGAAAGCCATTCTTCATGTTCTTAGCAACCGAGTGAACGATGCAGGGTTCTATCGACCGGATGCATATGCAGAAGAGGACCCATTTAAACCCGGACCTCATTATCTCAAACAAGAATTTACTTGA ATGTGGGATTACAGGTTCATGGTGACGAAGAAGGATGAGATGTCGATCTTCAAAATGGATCGAATTCCATTCCTTGAAGAACAGGTAAGGAAGGTAAAGGAACAGGGGAAGCTCATAACAATGGACATCGAAAGACTTCTGCTATCAGAGGACAACCGCTTCGATTTTGTGAACGAGGTTGCAGCGGAGGCTAAGGATTACGTGGAGAACAATCGTGATGAATATGGGGGTTCCAAGAAAGCCATTCTTCATGTTCTTAGCAACCGAGTGAACGATGCAGGGTTCTATCGACCGGATGCATATGCAGAAGAGGACCCATTTAAACCCGGACCTCATTATCTCAAACAAGAATTTACTTGA MWDYRFMVTKKDEMSIFKMDRIPFLEEQVRKVKEQGKLITMDIERLLLSEDNRFDFVNEVAAEAKDYVENNRDEYGGSKKAILHVLSNRVNDAGFYRPDAYAEEDPFKPGPHYLKQEFT
BLAST of Cp4.1LG14g07010 vs. Swiss-Prot
Match: PTA7_ARATH (Protein PLASTID TRANSCRIPTIONALLY ACTIVE 7 OS=Arabidopsis thaliana GN=PTAC7 PE=1 SV=1) HSP 1 Score: 168.3 bits (425), Expect = 5.0e-41 Identity = 80/115 (69.57%), Postives = 97/115 (84.35%), Query Frame = 1
BLAST of Cp4.1LG14g07010 vs. TrEMBL
Match: A0A0A0L9J8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G238200 PE=4 SV=1) HSP 1 Score: 216.5 bits (550), Expect = 1.8e-53 Identity = 105/115 (91.30%), Postives = 113/115 (98.26%), Query Frame = 1
BLAST of Cp4.1LG14g07010 vs. TrEMBL
Match: A0A061G1Y5_THECC (Plastid transcriptionally active7 isoform 1 OS=Theobroma cacao GN=TCM_015438 PE=4 SV=1) HSP 1 Score: 199.1 bits (505), Expect = 3.0e-48 Identity = 95/115 (82.61%), Postives = 108/115 (93.91%), Query Frame = 1
BLAST of Cp4.1LG14g07010 vs. TrEMBL
Match: A0A061G324_THECC (Plastid transcriptionally active7 isoform 2 OS=Theobroma cacao GN=TCM_015438 PE=4 SV=1) HSP 1 Score: 198.7 bits (504), Expect = 3.9e-48 Identity = 94/111 (84.68%), Postives = 106/111 (95.50%), Query Frame = 1
BLAST of Cp4.1LG14g07010 vs. TrEMBL
Match: A0A0D2Q2J5_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G267700 PE=4 SV=1) HSP 1 Score: 198.0 bits (502), Expect = 6.6e-48 Identity = 95/115 (82.61%), Postives = 107/115 (93.04%), Query Frame = 1
BLAST of Cp4.1LG14g07010 vs. TrEMBL
Match: A0A0B0MTV6_GOSAR (Putative nicotinate-nucleotide adenylyltransferase OS=Gossypium arboreum GN=F383_10117 PE=4 SV=1) HSP 1 Score: 198.0 bits (502), Expect = 6.6e-48 Identity = 95/115 (82.61%), Postives = 107/115 (93.04%), Query Frame = 1
BLAST of Cp4.1LG14g07010 vs. TAIR10
Match: AT5G24314.2 (AT5G24314.2 plastid transcriptionally active7) HSP 1 Score: 168.7 bits (426), Expect = 2.2e-42 Identity = 79/113 (69.91%), Postives = 97/113 (85.84%), Query Frame = 1
BLAST of Cp4.1LG14g07010 vs. NCBI nr
Match: gi|659111938|ref|XP_008455984.1| (PREDICTED: uncharacterized protein LOC103496049 [Cucumis melo]) HSP 1 Score: 217.6 bits (553), Expect = 1.2e-53 Identity = 106/115 (92.17%), Postives = 113/115 (98.26%), Query Frame = 1
BLAST of Cp4.1LG14g07010 vs. NCBI nr
Match: gi|449456989|ref|XP_004146231.1| (PREDICTED: uncharacterized protein LOC101217841 [Cucumis sativus]) HSP 1 Score: 216.5 bits (550), Expect = 2.6e-53 Identity = 105/115 (91.30%), Postives = 113/115 (98.26%), Query Frame = 1
BLAST of Cp4.1LG14g07010 vs. NCBI nr
Match: gi|590674163|ref|XP_007039090.1| (Plastid transcriptionally active7 isoform 1 [Theobroma cacao]) HSP 1 Score: 199.1 bits (505), Expect = 4.3e-48 Identity = 95/115 (82.61%), Postives = 108/115 (93.91%), Query Frame = 1
BLAST of Cp4.1LG14g07010 vs. NCBI nr
Match: gi|590674166|ref|XP_007039091.1| (Plastid transcriptionally active7 isoform 2 [Theobroma cacao]) HSP 1 Score: 198.7 bits (504), Expect = 5.6e-48 Identity = 94/111 (84.68%), Postives = 106/111 (95.50%), Query Frame = 1
BLAST of Cp4.1LG14g07010 vs. NCBI nr
Match: gi|823214450|ref|XP_012439977.1| (PREDICTED: uncharacterized protein LOC105765437 isoform X2 [Gossypium raimondii]) HSP 1 Score: 198.0 bits (502), Expect = 9.5e-48 Identity = 95/115 (82.61%), Postives = 107/115 (93.04%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |