Cp4.1LG13g06200 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAATCTCTGGAGCCCACTTTCCAGCTCCTGGAAACTATGGCATGATCCAAAACCTCAATACCAATGGATTCTCGTCTTATAATCCGGTTAGCTCAACCTCCACTTCTGATGATGGTAATGATCAGAACCAGATACCGAGGTTCGTCATCGATGAGAGGAAGCAAAGGAGAATGGTATCGAATAGGGAGTCGGCGCGAAGGTCACGGATGAGGAAACAGAAGCATCTTGATGAACTTTGGTCCCTGGTGGTTCGTCTTCGAACTGAGAATCATAGTCTTATGAAGAAGTTGAATCAGTTGACAGAATTCCAACAGCAGCTTCTTCAAGAGAATGTCAAGCTCAAAGAAGAAGCCTCGGATTTTCGTCGGATGATCGCTGACATTCAAATGTGCAGTCCTTACACAACTCACTTGAGAGATCTGGAGGAAGCCCCATGA ATGGAAATCTCTGGAGCCCACTTTCCAGCTCCTGGAAACTATGGCATGATCCAAAACCTCAATACCAATGGATTCTCGTCTTATAATCCGGTTAGCTCAACCTCCACTTCTGATGATGGTAATGATCAGAACCAGATACCGAGGTTCGTCATCGATGAGAGGAAGCAAAGGAGAATGGTATCGAATAGGGAGTCGGCGCGAAGGTCACGGATGAGGAAACAGAAGCATCTTGATGAACTTTGGTCCCTGGTGGTTCGTCTTCGAACTGAGAATCATAGTCTTATGAAGAAGTTGAATCAGTTGACAGAATTCCAACAGCAGCTTCTTCAAGAGAATGTCAAGCTCAAAGAAGAAGCCTCGGATTTTCGTCGGATGATCGCTGACATTCAAATGTGCAGTCCTTACACAACTCACTTGAGAGATCTGGAGGAAGCCCCATGA ATGGAAATCTCTGGAGCCCACTTTCCAGCTCCTGGAAACTATGGCATGATCCAAAACCTCAATACCAATGGATTCTCGTCTTATAATCCGGTTAGCTCAACCTCCACTTCTGATGATGGTAATGATCAGAACCAGATACCGAGGTTCGTCATCGATGAGAGGAAGCAAAGGAGAATGGTATCGAATAGGGAGTCGGCGCGAAGGTCACGGATGAGGAAACAGAAGCATCTTGATGAACTTTGGTCCCTGGTGGTTCGTCTTCGAACTGAGAATCATAGTCTTATGAAGAAGTTGAATCAGTTGACAGAATTCCAACAGCAGCTTCTTCAAGAGAATGTCAAGCTCAAAGAAGAAGCCTCGGATTTTCGTCGGATGATCGCTGACATTCAAATGTGCAGTCCTTACACAACTCACTTGAGAGATCTGGAGGAAGCCCCATGA MEISGAHFPAPGNYGMIQNLNTNGFSSYNPVSSTSTSDDGNDQNQIPRFVIDERKQRRMVSNRESARRSRMRKQKHLDELWSLVVRLRTENHSLMKKLNQLTEFQQQLLQENVKLKEEASDFRRMIADIQMCSPYTTHLRDLEEAP
BLAST of Cp4.1LG13g06200 vs. Swiss-Prot
Match: BZP43_ARATH (Basic leucine zipper 43 OS=Arabidopsis thaliana GN=BZIP43 PE=1 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 9.3e-21 Identity = 56/112 (50.00%), Postives = 88/112 (78.57%), Query Frame = 1
BLAST of Cp4.1LG13g06200 vs. Swiss-Prot
Match: BZIP8_ARATH (Basic leucine zipper 8 OS=Arabidopsis thaliana GN=BZIP8 PE=1 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 3.4e-15 Identity = 48/95 (50.53%), Postives = 72/95 (75.79%), Query Frame = 1
BLAST of Cp4.1LG13g06200 vs. Swiss-Prot
Match: BZIP2_ARATH (bZIP transcription factor 2 OS=Arabidopsis thaliana GN=BZIP2 PE=1 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.3e-09 Identity = 38/96 (39.58%), Postives = 60/96 (62.50%), Query Frame = 1
BLAST of Cp4.1LG13g06200 vs. Swiss-Prot
Match: BZP44_ARATH (bZIP transcription factor 44 OS=Arabidopsis thaliana GN=BZIP44 PE=1 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 6.2e-09 Identity = 39/99 (39.39%), Postives = 60/99 (60.61%), Query Frame = 1
BLAST of Cp4.1LG13g06200 vs. Swiss-Prot
Match: BZP53_ARATH (bZIP transcription factor 53 OS=Arabidopsis thaliana GN=BZIP53 PE=1 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 1.2e-07 Identity = 38/106 (35.85%), Postives = 66/106 (62.26%), Query Frame = 1
BLAST of Cp4.1LG13g06200 vs. TrEMBL
Match: A0A0A0KJA6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G137430 PE=4 SV=1) HSP 1 Score: 208.4 bits (529), Expect = 6.0e-51 Identity = 113/146 (77.40%), Postives = 123/146 (84.25%), Query Frame = 1
BLAST of Cp4.1LG13g06200 vs. TrEMBL
Match: B9HIW1_POPTR (BZIP family protein OS=Populus trichocarpa GN=POPTR_0008s11260g PE=4 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 1.4e-31 Identity = 87/173 (50.29%), Postives = 118/173 (68.21%), Query Frame = 1
BLAST of Cp4.1LG13g06200 vs. TrEMBL
Match: B9HWS1_POPTR (BZIP family protein OS=Populus trichocarpa GN=POPTR_0010s14530g PE=4 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 9.0e-31 Identity = 83/158 (52.53%), Postives = 109/158 (68.99%), Query Frame = 1
BLAST of Cp4.1LG13g06200 vs. TrEMBL
Match: A0A0D2PWI5_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G251000 PE=4 SV=1) HSP 1 Score: 140.6 bits (353), Expect = 1.5e-30 Identity = 88/174 (50.57%), Postives = 110/174 (63.22%), Query Frame = 1
BLAST of Cp4.1LG13g06200 vs. TrEMBL
Match: B9RLD3_RICCO (Ocs element-binding factor, putative OS=Ricinus communis GN=RCOM_1465160 PE=4 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 9.9e-30 Identity = 76/117 (64.96%), Postives = 98/117 (83.76%), Query Frame = 1
BLAST of Cp4.1LG13g06200 vs. TAIR10
Match: AT1G13600.1 (AT1G13600.1 basic leucine-zipper 58) HSP 1 Score: 119.0 bits (297), Expect = 2.4e-27 Identity = 72/134 (53.73%), Postives = 99/134 (73.88%), Query Frame = 1
BLAST of Cp4.1LG13g06200 vs. TAIR10
Match: AT3G30530.1 (AT3G30530.1 basic leucine-zipper 42) HSP 1 Score: 115.2 bits (287), Expect = 3.5e-26 Identity = 71/149 (47.65%), Postives = 97/149 (65.10%), Query Frame = 1
BLAST of Cp4.1LG13g06200 vs. TAIR10
Match: AT2G04038.1 (AT2G04038.1 basic leucine-zipper 48) HSP 1 Score: 110.9 bits (276), Expect = 6.6e-25 Identity = 64/116 (55.17%), Postives = 90/116 (77.59%), Query Frame = 1
BLAST of Cp4.1LG13g06200 vs. TAIR10
Match: AT5G38800.1 (AT5G38800.1 basic leucine-zipper 43) HSP 1 Score: 101.3 bits (251), Expect = 5.2e-22 Identity = 56/112 (50.00%), Postives = 88/112 (78.57%), Query Frame = 1
BLAST of Cp4.1LG13g06200 vs. TAIR10
Match: AT5G15830.1 (AT5G15830.1 basic leucine-zipper 3) HSP 1 Score: 98.2 bits (243), Expect = 4.4e-21 Identity = 64/118 (54.24%), Postives = 82/118 (69.49%), Query Frame = 1
BLAST of Cp4.1LG13g06200 vs. NCBI nr
Match: gi|659072537|ref|XP_008466040.1| (PREDICTED: light-inducible protein CPRF2 [Cucumis melo]) HSP 1 Score: 220.7 bits (561), Expect = 1.7e-54 Identity = 115/146 (78.77%), Postives = 128/146 (87.67%), Query Frame = 1
BLAST of Cp4.1LG13g06200 vs. NCBI nr
Match: gi|778698588|ref|XP_011654565.1| (PREDICTED: basic leucine zipper 43 [Cucumis sativus]) HSP 1 Score: 208.4 bits (529), Expect = 8.6e-51 Identity = 113/146 (77.40%), Postives = 123/146 (84.25%), Query Frame = 1
BLAST of Cp4.1LG13g06200 vs. NCBI nr
Match: gi|224099281|ref|XP_002311422.1| (bZIP family protein [Populus trichocarpa]) HSP 1 Score: 144.1 bits (362), Expect = 2.0e-31 Identity = 87/173 (50.29%), Postives = 118/173 (68.21%), Query Frame = 1
BLAST of Cp4.1LG13g06200 vs. NCBI nr
Match: gi|224111822|ref|XP_002315989.1| (bZIP family protein [Populus trichocarpa]) HSP 1 Score: 141.4 bits (355), Expect = 1.3e-30 Identity = 83/158 (52.53%), Postives = 109/158 (68.99%), Query Frame = 1
BLAST of Cp4.1LG13g06200 vs. NCBI nr
Match: gi|743784013|ref|XP_011021268.1| (PREDICTED: basic leucine zipper 43-like [Populus euphratica]) HSP 1 Score: 141.0 bits (354), Expect = 1.7e-30 Identity = 85/173 (49.13%), Postives = 116/173 (67.05%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: None |