Carg01362 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAATCTCTGGAGCTCACTTTCCAGCTCCTGGAAACCATGGCATGATCCAAAACCTCAATACCAATGGATTCTCGTCTTATAATCCGGTTAGCTCAACCTCCACTTCTGATGATGGTAATGATCAGAACCAGATACTACCTGGGTTCGTCATCGATGAGAGGAAGCAAAGGAGAATGGTATCAAATCGGGAGTCGGCACGAAGGTCACGGATGAGGAAACAGAAGCATCTTGATGAACTTTGGTCCTTGGTGGTTCATCTTCGTACTGAGAATCATAGTCTTATGAAGAAGTTGAATCAGTTGACAGAATTCCAACAGCAGCTTCTTCAAGAGAATGTCAAGCTCAAAGAAGAAGCCTCGGATTTTCGTCGGATGATCGCTGACATTCAAATGTGCAGTCCTTACACAACTCACTTGAGAGATCTGGAGGAAGCCCCATGA ATGGAAATCTCTGGAGCTCACTTTCCAGCTCCTGGAAACCATGGCATGATCCAAAACCTCAATACCAATGGATTCTCGTCTTATAATCCGGTTAGCTCAACCTCCACTTCTGATGATGGTAATGATCAGAACCAGATACTACCTGGGTTCGTCATCGATGAGAGGAAGCAAAGGAGAATGGTATCAAATCGGGAGTCGGCACGAAGGTCACGGATGAGGAAACAGAAGCATCTTGATGAACTTTGGTCCTTGGTGGTTCATCTTCGTACTGAGAATCATAGTCTTATGAAGAAGTTGAATCAGTTGACAGAATTCCAACAGCAGCTTCTTCAAGAGAATGTCAAGCTCAAAGAAGAAGCCTCGGATTTTCGTCGGATGATCGCTGACATTCAAATGTGCAGTCCTTACACAACTCACTTGAGAGATCTGGAGGAAGCCCCATGA ATGGAAATCTCTGGAGCTCACTTTCCAGCTCCTGGAAACCATGGCATGATCCAAAACCTCAATACCAATGGATTCTCGTCTTATAATCCGGTTAGCTCAACCTCCACTTCTGATGATGGTAATGATCAGAACCAGATACTACCTGGGTTCGTCATCGATGAGAGGAAGCAAAGGAGAATGGTATCAAATCGGGAGTCGGCACGAAGGTCACGGATGAGGAAACAGAAGCATCTTGATGAACTTTGGTCCTTGGTGGTTCATCTTCGTACTGAGAATCATAGTCTTATGAAGAAGTTGAATCAGTTGACAGAATTCCAACAGCAGCTTCTTCAAGAGAATGTCAAGCTCAAAGAAGAAGCCTCGGATTTTCGTCGGATGATCGCTGACATTCAAATGTGCAGTCCTTACACAACTCACTTGAGAGATCTGGAGGAAGCCCCATGA MEISGAHFPAPGNHGMIQNLNTNGFSSYNPVSSTSTSDDGNDQNQILPGFVIDERKQRRMVSNRESARRSRMRKQKHLDELWSLVVHLRTENHSLMKKLNQLTEFQQQLLQENVKLKEEASDFRRMIADIQMCSPYTTHLRDLEEAP
BLAST of Carg01362 vs. NCBI nr
Match: XP_022939453.1 (basic leucine zipper 43-like [Cucurbita moschata]) HSP 1 Score: 274.2 bits (700), Expect = 2.5e-70 Identity = 143/147 (97.28%), Postives = 144/147 (97.96%), Query Frame = 0
BLAST of Carg01362 vs. NCBI nr
Match: XP_023550782.1 (basic leucine zipper 43-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 273.5 bits (698), Expect = 4.3e-70 Identity = 143/147 (97.28%), Postives = 144/147 (97.96%), Query Frame = 0
BLAST of Carg01362 vs. NCBI nr
Match: XP_022994074.1 (basic leucine zipper 43-like [Cucurbita maxima]) HSP 1 Score: 254.2 bits (648), Expect = 2.7e-64 Identity = 135/147 (91.84%), Postives = 138/147 (93.88%), Query Frame = 0
BLAST of Carg01362 vs. NCBI nr
Match: XP_016898848.1 (PREDICTED: basic leucine zipper 43 [Cucumis melo] >XP_016898849.1 PREDICTED: basic leucine zipper 43 [Cucumis melo]) HSP 1 Score: 211.1 bits (536), Expect = 2.6e-51 Identity = 112/147 (76.19%), Postives = 126/147 (85.71%), Query Frame = 0
BLAST of Carg01362 vs. NCBI nr
Match: XP_011654565.1 (PREDICTED: basic leucine zipper 43 [Cucumis sativus] >KGN49810.1 hypothetical protein Csa_5G137430 [Cucumis sativus]) HSP 1 Score: 209.5 bits (532), Expect = 7.6e-51 Identity = 114/147 (77.55%), Postives = 125/147 (85.03%), Query Frame = 0
BLAST of Carg01362 vs. TAIR10
Match: AT5G15830.1 (basic leucine-zipper 3) HSP 1 Score: 94.0 bits (232), Expect = 8.4e-20 Identity = 51/82 (62.20%), Postives = 65/82 (79.27%), Query Frame = 0
BLAST of Carg01362 vs. TAIR10
Match: AT3G30530.1 (basic leucine-zipper 42) HSP 1 Score: 79.7 bits (195), Expect = 1.6e-15 Identity = 39/74 (52.70%), Postives = 56/74 (75.68%), Query Frame = 0
BLAST of Carg01362 vs. TAIR10
Match: AT1G13600.1 (basic leucine-zipper 58) HSP 1 Score: 78.2 bits (191), Expect = 4.8e-15 Identity = 38/62 (61.29%), Postives = 51/62 (82.26%), Query Frame = 0
BLAST of Carg01362 vs. TAIR10
Match: AT5G38800.1 (basic leucine-zipper 43) HSP 1 Score: 75.1 bits (183), Expect = 4.0e-14 Identity = 49/113 (43.36%), Postives = 71/113 (62.83%), Query Frame = 0
BLAST of Carg01362 vs. TAIR10
Match: AT2G04038.1 (basic leucine-zipper 48) HSP 1 Score: 73.9 bits (180), Expect = 9.0e-14 Identity = 36/62 (58.06%), Postives = 51/62 (82.26%), Query Frame = 0
BLAST of Carg01362 vs. Swiss-Prot
Match: sp|Q9FMC2|BZP43_ARATH (Basic leucine zipper 43 OS=Arabidopsis thaliana OX=3702 GN=BZIP43 PE=1 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 7.3e-13 Identity = 49/113 (43.36%), Postives = 71/113 (62.83%), Query Frame = 0
BLAST of Carg01362 vs. Swiss-Prot
Match: sp|Q9CA46|BZIP8_ARATH (Basic leucine zipper 8 OS=Arabidopsis thaliana OX=3702 GN=BZIP8 PE=1 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 8.3e-09 Identity = 30/61 (49.18%), Postives = 48/61 (78.69%), Query Frame = 0
BLAST of Carg01362 vs. Swiss-Prot
Match: sp|Q9LZP8|BZP53_ARATH (bZIP transcription factor 53 OS=Arabidopsis thaliana OX=3702 GN=BZIP53 PE=1 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 1.2e-07 Identity = 36/101 (35.64%), Postives = 63/101 (62.38%), Query Frame = 0
BLAST of Carg01362 vs. Swiss-Prot
Match: sp|Q99090|CPRF2_PETCR (Light-inducible protein CPRF2 OS=Petroselinum crispum OX=4043 GN=CPRF2 PE=2 SV=2) HSP 1 Score: 55.8 bits (133), Expect = 4.6e-07 Identity = 36/80 (45.00%), Postives = 50/80 (62.50%), Query Frame = 0
BLAST of Carg01362 vs. Swiss-Prot
Match: sp|B9DGI8|BZP63_ARATH (Basic leucine zipper 63 OS=Arabidopsis thaliana OX=3702 GN=BZIP63 PE=1 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 5.0e-06 Identity = 34/73 (46.58%), Postives = 42/73 (57.53%), Query Frame = 0
BLAST of Carg01362 vs. TrEMBL
Match: tr|A0A1S4DS86|A0A1S4DS86_CUCME (basic leucine zipper 43 OS=Cucumis melo OX=3656 GN=LOC103503588 PE=4 SV=1) HSP 1 Score: 211.1 bits (536), Expect = 1.7e-51 Identity = 112/147 (76.19%), Postives = 126/147 (85.71%), Query Frame = 0
BLAST of Carg01362 vs. TrEMBL
Match: tr|A0A0A0KJA6|A0A0A0KJA6_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G137430 PE=4 SV=1) HSP 1 Score: 209.5 bits (532), Expect = 5.0e-51 Identity = 114/147 (77.55%), Postives = 125/147 (85.03%), Query Frame = 0
BLAST of Carg01362 vs. TrEMBL
Match: tr|A0A2N9HRN4|A0A2N9HRN4_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS42302 PE=4 SV=1) HSP 1 Score: 145.6 bits (366), Expect = 8.9e-32 Identity = 81/143 (56.64%), Postives = 107/143 (74.83%), Query Frame = 0
BLAST of Carg01362 vs. TrEMBL
Match: tr|A0A2P4LBR1|A0A2P4LBR1_QUESU (Basic leucine zipper 43 OS=Quercus suber OX=58331 GN=CFP56_04942 PE=4 SV=1) HSP 1 Score: 145.6 bits (366), Expect = 8.9e-32 Identity = 80/138 (57.97%), Postives = 105/138 (76.09%), Query Frame = 0
BLAST of Carg01362 vs. TrEMBL
Match: tr|A0A1Q3ATT5|A0A1Q3ATT5_CEPFO (BZIP_1 domain-containing protein OS=Cephalotus follicularis OX=3775 GN=CFOL_v3_02618 PE=4 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 2.2e-30 Identity = 78/145 (53.79%), Postives = 104/145 (71.72%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: None |