Cp4.1LG12g05310 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATATGAATGCAGTGAAAGGGTTGGTGGCCGAGAAGCCAGTAGTGATCTTCAGTAGAAGCCAATGCTCGATGAGCTATACAGTAAAGACACTCATATCAAGCTTTGGGGCTAATCCTACAGTGTATGAGCTTGATGAGATACCCAATGGGCATCAGATTGAGACACTGCTGCTTCAACTAGGATGCGAGCCATGTGTGCCTGTTGTGTTCATTGGGCAGAAGTTAATTGGTGGTGCTAGAGAGCTCATGAGCCTGCAGGTCAGGAACGAGCTTATGCCATTGCTCATGAGTGCCAGAGCTATATGGGTTTGA ATGGATATGAATGCAGTGAAAGGGTTGGTGGCCGAGAAGCCAGTAGTGATCTTCAGTAGAAGCCAATGCTCGATGAGCTATACAGTAAAGACACTCATATCAAGCTTTGGGGCTAATCCTACAGTGTATGAGCTTGATGAGATACCCAATGGGCATCAGATTGAGACACTGCTGCTTCAACTAGGATGCGAGCCATGTGTGCCTGTTGTGTTCATTGGGCAGAAGTTAATTGGTGGTGCTAGAGAGCTCATGAGCCTGCAGGTCAGGAACGAGCTTATGCCATTGCTCATGAGTGCCAGAGCTATATGGGTTTGA ATGGATATGAATGCAGTGAAAGGGTTGGTGGCCGAGAAGCCAGTAGTGATCTTCAGTAGAAGCCAATGCTCGATGAGCTATACAGTAAAGACACTCATATCAAGCTTTGGGGCTAATCCTACAGTGTATGAGCTTGATGAGATACCCAATGGGCATCAGATTGAGACACTGCTGCTTCAACTAGGATGCGAGCCATGTGTGCCTGTTGTGTTCATTGGGCAGAAGTTAATTGGTGGTGCTAGAGAGCTCATGAGCCTGCAGGTCAGGAACGAGCTTATGCCATTGCTCATGAGTGCCAGAGCTATATGGGTTTGA MDMNAVKGLVAEKPVVIFSRSQCSMSYTVKTLISSFGANPTVYELDEIPNGHQIETLLLQLGCEPCVPVVFIGQKLIGGARELMSLQVRNELMPLLMSARAIWV
BLAST of Cp4.1LG12g05310 vs. Swiss-Prot
Match: GRXS1_ARATH (Monothiol glutaredoxin-S1 OS=Arabidopsis thaliana GN=GRXS1 PE=3 SV=1) HSP 1 Score: 131.7 bits (330), Expect = 4.6e-30 Identity = 61/102 (59.80%), Postives = 81/102 (79.41%), Query Frame = 1
BLAST of Cp4.1LG12g05310 vs. Swiss-Prot
Match: GRXS6_ARATH (Monothiol glutaredoxin-S6 OS=Arabidopsis thaliana GN=GRXS6 PE=3 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 3.0e-29 Identity = 60/102 (58.82%), Postives = 80/102 (78.43%), Query Frame = 1
BLAST of Cp4.1LG12g05310 vs. Swiss-Prot
Match: GRXS2_ARATH (Monothiol glutaredoxin-S2 OS=Arabidopsis thaliana GN=GRXS2 PE=3 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 4.3e-28 Identity = 58/102 (56.86%), Postives = 76/102 (74.51%), Query Frame = 1
BLAST of Cp4.1LG12g05310 vs. Swiss-Prot
Match: GRXS5_ARATH (Monothiol glutaredoxin-S5 OS=Arabidopsis thaliana GN=GRXS5 PE=3 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 1.8e-26 Identity = 55/102 (53.92%), Postives = 75/102 (73.53%), Query Frame = 1
BLAST of Cp4.1LG12g05310 vs. Swiss-Prot
Match: GRXS4_ARATH (Monothiol glutaredoxin-S4 OS=Arabidopsis thaliana GN=GRXS4 PE=3 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 1.8e-26 Identity = 54/102 (52.94%), Postives = 75/102 (73.53%), Query Frame = 1
BLAST of Cp4.1LG12g05310 vs. TrEMBL
Match: U3RJA5_CUCSA (Glutaredoxin OS=Cucumis sativus GN=GRX8 PE=2 SV=1) HSP 1 Score: 204.9 bits (520), Expect = 4.7e-50 Identity = 101/104 (97.12%), Postives = 103/104 (99.04%), Query Frame = 1
BLAST of Cp4.1LG12g05310 vs. TrEMBL
Match: A0A067H8Q0_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g039608mg PE=4 SV=1) HSP 1 Score: 145.2 bits (365), Expect = 4.4e-32 Identity = 70/100 (70.00%), Postives = 84/100 (84.00%), Query Frame = 1
BLAST of Cp4.1LG12g05310 vs. TrEMBL
Match: A0A0D2PLU4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G009100 PE=4 SV=1) HSP 1 Score: 145.2 bits (365), Expect = 4.4e-32 Identity = 67/102 (65.69%), Postives = 85/102 (83.33%), Query Frame = 1
BLAST of Cp4.1LG12g05310 vs. TrEMBL
Match: B9S3V2_RICCO (Glutaredoxin, grx, putative OS=Ricinus communis GN=RCOM_0555440 PE=4 SV=1) HSP 1 Score: 144.8 bits (364), Expect = 5.8e-32 Identity = 68/102 (66.67%), Postives = 83/102 (81.37%), Query Frame = 1
BLAST of Cp4.1LG12g05310 vs. TrEMBL
Match: B9I9V9_POPTR (Glutaredoxin family protein OS=Populus trichocarpa GN=POPTR_0014s12850g PE=4 SV=1) HSP 1 Score: 144.4 bits (363), Expect = 7.6e-32 Identity = 70/103 (67.96%), Postives = 86/103 (83.50%), Query Frame = 1
BLAST of Cp4.1LG12g05310 vs. TAIR10
Match: AT1G03020.1 (AT1G03020.1 Thioredoxin superfamily protein) HSP 1 Score: 131.7 bits (330), Expect = 2.6e-31 Identity = 61/102 (59.80%), Postives = 81/102 (79.41%), Query Frame = 1
BLAST of Cp4.1LG12g05310 vs. TAIR10
Match: AT3G62930.1 (AT3G62930.1 Thioredoxin superfamily protein) HSP 1 Score: 129.0 bits (323), Expect = 1.7e-30 Identity = 60/102 (58.82%), Postives = 80/102 (78.43%), Query Frame = 1
BLAST of Cp4.1LG12g05310 vs. TAIR10
Match: AT5G18600.1 (AT5G18600.1 Thioredoxin superfamily protein) HSP 1 Score: 125.2 bits (313), Expect = 2.4e-29 Identity = 58/102 (56.86%), Postives = 76/102 (74.51%), Query Frame = 1
BLAST of Cp4.1LG12g05310 vs. TAIR10
Match: AT4G15690.1 (AT4G15690.1 Thioredoxin superfamily protein) HSP 1 Score: 119.8 bits (299), Expect = 1.0e-27 Identity = 55/102 (53.92%), Postives = 75/102 (73.53%), Query Frame = 1
BLAST of Cp4.1LG12g05310 vs. TAIR10
Match: AT4G15680.1 (AT4G15680.1 Thioredoxin superfamily protein) HSP 1 Score: 119.8 bits (299), Expect = 1.0e-27 Identity = 54/102 (52.94%), Postives = 75/102 (73.53%), Query Frame = 1
BLAST of Cp4.1LG12g05310 vs. NCBI nr
Match: gi|821595228|ref|NP_001295830.1| (monothiol glutaredoxin-S1-like [Cucumis sativus]) HSP 1 Score: 204.9 bits (520), Expect = 6.8e-50 Identity = 101/104 (97.12%), Postives = 103/104 (99.04%), Query Frame = 1
BLAST of Cp4.1LG12g05310 vs. NCBI nr
Match: gi|743870506|ref|XP_011033597.1| (PREDICTED: monothiol glutaredoxin-S6-like [Populus euphratica]) HSP 1 Score: 145.2 bits (365), Expect = 6.4e-32 Identity = 71/103 (68.93%), Postives = 85/103 (82.52%), Query Frame = 1
BLAST of Cp4.1LG12g05310 vs. NCBI nr
Match: gi|568852444|ref|XP_006479886.1| (PREDICTED: monothiol glutaredoxin-S1 [Citrus sinensis]) HSP 1 Score: 145.2 bits (365), Expect = 6.4e-32 Identity = 70/100 (70.00%), Postives = 84/100 (84.00%), Query Frame = 1
BLAST of Cp4.1LG12g05310 vs. NCBI nr
Match: gi|823201603|ref|XP_012435630.1| (PREDICTED: monothiol glutaredoxin-S1 [Gossypium raimondii]) HSP 1 Score: 145.2 bits (365), Expect = 6.4e-32 Identity = 67/102 (65.69%), Postives = 85/102 (83.33%), Query Frame = 1
BLAST of Cp4.1LG12g05310 vs. NCBI nr
Match: gi|255559302|ref|XP_002520671.1| (PREDICTED: monothiol glutaredoxin-S1 [Ricinus communis]) HSP 1 Score: 144.8 bits (364), Expect = 8.3e-32 Identity = 68/102 (66.67%), Postives = 83/102 (81.37%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|