Cp4.1LG10g11980 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGATTGGTCCTTACGTGTGTGCCGAGTGGAACTACGGAGGTTTTCCACTATGGTTGCACAATATGCCAGGAATCCAACTACGAACTGACAATCAAGTCTACAAAAATGAAATGCAAACTTTCACGACGAAAATAGTGAATATGTGTAACCAAGCTAACCTCTTTGCATCACAAGGAGGACCAATAATCTTAGCTCAAATCGAGAACGAGTATGGAAACGTGATGACACCTTATGGAAATGCAGGAGGAACATACATCAATTGGTGCACTCAAATGACCAAATCTCCTAATATTGGCGTTCCATGGATCATGGGCCAATAG ATGATGATTGGTCCTTACGTGTGTGCCGAGTGGAACTACGGAGGTTTTCCACTATGGTTGCACAATATGCCAGGAATCCAACTACGAACTGACAATCAAGTCTACAAAAATGAAATGCAAACTTTCACGACGAAAATAGTGAATATGTGTAACCAAGCTAACCTCTTTGCATCACAAGGAGGACCAATAATCTTAGCTCAAATCGAGAACGAGTATGGAAACGTGATGACACCTTATGGAAATGCAGGAGGAACATACATCAATTGGTGCACTCAAATGACCAAATCTCCTAATATTGGCGTTCCATGGATCATGGGCCAATAG ATGATGATTGGTCCTTACGTGTGTGCCGAGTGGAACTACGGAGGTTTTCCACTATGGTTGCACAATATGCCAGGAATCCAACTACGAACTGACAATCAAGTCTACAAAAATGAAATGCAAACTTTCACGACGAAAATAGTGAATATGTGTAACCAAGCTAACCTCTTTGCATCACAAGGAGGACCAATAATCTTAGCTCAAATCGAGAACGAGTATGGAAACGTGATGACACCTTATGGAAATGCAGGAGGAACATACATCAATTGGTGCACTCAAATGACCAAATCTCCTAATATTGGCGTTCCATGGATCATGGGCCAATAG MMIGPYVCAEWNYGGFPLWLHNMPGIQLRTDNQVYKNEMQTFTTKIVNMCNQANLFASQGGPIILAQIENEYGNVMTPYGNAGGTYINWCTQMTKSPNIGVPWIMGQ
BLAST of Cp4.1LG10g11980 vs. Swiss-Prot
Match: BGA15_ARATH (Beta-galactosidase 15 OS=Arabidopsis thaliana GN=BGAL15 PE=2 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 5.9e-41 Identity = 73/107 (68.22%), Postives = 82/107 (76.64%), Query Frame = 1
BLAST of Cp4.1LG10g11980 vs. Swiss-Prot
Match: BGAL_BRAOL (Beta-galactosidase OS=Brassica oleracea PE=2 SV=1) HSP 1 Score: 167.5 bits (423), Expect = 7.7e-41 Identity = 74/107 (69.16%), Postives = 85/107 (79.44%), Query Frame = 1
BLAST of Cp4.1LG10g11980 vs. Swiss-Prot
Match: BGAL7_ARATH (Beta-galactosidase 7 OS=Arabidopsis thaliana GN=BGAL7 PE=2 SV=2) HSP 1 Score: 164.9 bits (416), Expect = 5.0e-40 Identity = 72/107 (67.29%), Postives = 83/107 (77.57%), Query Frame = 1
BLAST of Cp4.1LG10g11980 vs. Swiss-Prot
Match: BGAL8_ARATH (Beta-galactosidase 8 OS=Arabidopsis thaliana GN=BGAL8 PE=2 SV=2) HSP 1 Score: 154.8 bits (390), Expect = 5.2e-37 Identity = 68/107 (63.55%), Postives = 82/107 (76.64%), Query Frame = 1
BLAST of Cp4.1LG10g11980 vs. Swiss-Prot
Match: BGAL6_ORYSJ (Beta-galactosidase 6 OS=Oryza sativa subsp. japonica GN=Os03g0255100 PE=1 SV=2) HSP 1 Score: 152.9 bits (385), Expect = 2.0e-36 Identity = 66/107 (61.68%), Postives = 81/107 (75.70%), Query Frame = 1
BLAST of Cp4.1LG10g11980 vs. TrEMBL
Match: A0A0A0LDH9_CUCSA (Beta-galactosidase OS=Cucumis sativus GN=Csa_3G550690 PE=3 SV=1) HSP 1 Score: 214.5 bits (545), Expect = 6.1e-53 Identity = 96/107 (89.72%), Postives = 99/107 (92.52%), Query Frame = 1
BLAST of Cp4.1LG10g11980 vs. TrEMBL
Match: A0A0A0LXX7_CUCSA (Beta-galactosidase OS=Cucumis sativus GN=Csa_1G643050 PE=3 SV=1) HSP 1 Score: 214.2 bits (544), Expect = 8.0e-53 Identity = 97/107 (90.65%), Postives = 98/107 (91.59%), Query Frame = 1
BLAST of Cp4.1LG10g11980 vs. TrEMBL
Match: A0A0A0M006_CUCSA (Beta-galactosidase OS=Cucumis sativus GN=Csa_1G650110 PE=3 SV=1) HSP 1 Score: 207.6 bits (527), Expect = 7.5e-51 Identity = 95/108 (87.96%), Postives = 99/108 (91.67%), Query Frame = 1
BLAST of Cp4.1LG10g11980 vs. TrEMBL
Match: A0A0A0KRM6_CUCSA (Beta-galactosidase OS=Cucumis sativus GN=Csa_5G169120 PE=3 SV=1) HSP 1 Score: 207.6 bits (527), Expect = 7.5e-51 Identity = 95/108 (87.96%), Postives = 99/108 (91.67%), Query Frame = 1
BLAST of Cp4.1LG10g11980 vs. TrEMBL
Match: A0A0A0KL41_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G168850 PE=4 SV=1) HSP 1 Score: 203.4 bits (516), Expect = 1.4e-49 Identity = 93/106 (87.74%), Postives = 97/106 (91.51%), Query Frame = 1
BLAST of Cp4.1LG10g11980 vs. TAIR10
Match: AT1G31740.1 (AT1G31740.1 beta-galactosidase 15) HSP 1 Score: 167.9 bits (424), Expect = 3.3e-42 Identity = 73/107 (68.22%), Postives = 82/107 (76.64%), Query Frame = 1
BLAST of Cp4.1LG10g11980 vs. TAIR10
Match: AT5G20710.1 (AT5G20710.1 beta-galactosidase 7) HSP 1 Score: 164.9 bits (416), Expect = 2.8e-41 Identity = 72/107 (67.29%), Postives = 83/107 (77.57%), Query Frame = 1
BLAST of Cp4.1LG10g11980 vs. TAIR10
Match: AT2G28470.1 (AT2G28470.1 beta-galactosidase 8) HSP 1 Score: 154.8 bits (390), Expect = 2.9e-38 Identity = 68/107 (63.55%), Postives = 82/107 (76.64%), Query Frame = 1
BLAST of Cp4.1LG10g11980 vs. TAIR10
Match: AT2G32810.1 (AT2G32810.1 beta galactosidase 9) HSP 1 Score: 144.1 bits (362), Expect = 5.1e-35 Identity = 60/105 (57.14%), Postives = 75/105 (71.43%), Query Frame = 1
BLAST of Cp4.1LG10g11980 vs. TAIR10
Match: AT3G13750.1 (AT3G13750.1 beta galactosidase 1) HSP 1 Score: 139.4 bits (350), Expect = 1.3e-33 Identity = 62/105 (59.05%), Postives = 73/105 (69.52%), Query Frame = 1
BLAST of Cp4.1LG10g11980 vs. NCBI nr
Match: gi|659118476|ref|XP_008459141.1| (PREDICTED: beta-galactosidase 15-like [Cucumis melo]) HSP 1 Score: 218.4 bits (555), Expect = 6.1e-54 Identity = 97/107 (90.65%), Postives = 100/107 (93.46%), Query Frame = 1
BLAST of Cp4.1LG10g11980 vs. NCBI nr
Match: gi|659129875|ref|XP_008464891.1| (PREDICTED: beta-galactosidase-like [Cucumis melo]) HSP 1 Score: 217.2 bits (552), Expect = 1.4e-53 Identity = 97/107 (90.65%), Postives = 100/107 (93.46%), Query Frame = 1
BLAST of Cp4.1LG10g11980 vs. NCBI nr
Match: gi|778688671|ref|XP_011652808.1| (PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase-like [Cucumis sativus]) HSP 1 Score: 214.5 bits (545), Expect = 8.8e-53 Identity = 96/107 (89.72%), Postives = 99/107 (92.52%), Query Frame = 1
BLAST of Cp4.1LG10g11980 vs. NCBI nr
Match: gi|700203008|gb|KGN58141.1| (hypothetical protein Csa_3G550690 [Cucumis sativus]) HSP 1 Score: 214.5 bits (545), Expect = 8.8e-53 Identity = 96/107 (89.72%), Postives = 99/107 (92.52%), Query Frame = 1
BLAST of Cp4.1LG10g11980 vs. NCBI nr
Match: gi|778665294|ref|XP_004135782.2| (PREDICTED: beta-galactosidase 15-like [Cucumis sativus]) HSP 1 Score: 214.5 bits (545), Expect = 8.8e-53 Identity = 95/107 (88.79%), Postives = 99/107 (92.52%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|