Cp4.1LG09g02650 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGGAAGAGACGGGGCTGGATATTGAGAAGGTTGAGTTTTTGAAAGTGACCAATAATTTGTTTTTGGATCAGCCAACGCCGGCTCATTATGTGGTGGTGTTCGTGCGGGCGGTGTTGGCTGATCCCATGCAAACTCCGCTCAATCTTGAGCCTGACAAATGTGGTGGCTGGGATTGGTATGAATGGGATAGTCTGCCCAAGCCACTCTTTGGTCCCATCAAAGCAATGGTTATGGAGGGCTTCAATCCTTTCCCATAA ATGAAGGAAGAGACGGGGCTGGATATTGAGAAGGTTGAGTTTTTGAAAGTGACCAATAATTTGTTTTTGGATCAGCCAACGCCGGCTCATTATGTGGTGGTGTTCGTGCGGGCGGTGTTGGCTGATCCCATGCAAACTCCGCTCAATCTTGAGCCTGACAAATGTGGTGGCTGGGATTGGTATGAATGGGATAGTCTGCCCAAGCCACTCTTTGGTCCCATCAAAGCAATGGTTATGGAGGGCTTCAATCCTTTCCCATAA ATGAAGGAAGAGACGGGGCTGGATATTGAGAAGGTTGAGTTTTTGAAAGTGACCAATAATTTGTTTTTGGATCAGCCAACGCCGGCTCATTATGTGGTGGTGTTCGTGCGGGCGGTGTTGGCTGATCCCATGCAAACTCCGCTCAATCTTGAGCCTGACAAATGTGGTGGCTGGGATTGGTATGAATGGGATAGTCTGCCCAAGCCACTCTTTGGTCCCATCAAAGCAATGGTTATGGAGGGCTTCAATCCTTTCCCATAA MKEETGLDIEKVEFLKVTNNLFLDQPTPAHYVVVFVRAVLADPMQTPLNLEPDKCGGWDWYEWDSLPKPLFGPIKAMVMEGFNPFP
BLAST of Cp4.1LG09g02650 vs. Swiss-Prot
Match: NUDT1_ARATH (Nudix hydrolase 1 OS=Arabidopsis thaliana GN=NUDT1 PE=1 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 7.1e-29 Identity = 52/83 (62.65%), Postives = 66/83 (79.52%), Query Frame = 1
BLAST of Cp4.1LG09g02650 vs. TrEMBL
Match: A0A0A0KR28_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G608210 PE=3 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 5.3e-39 Identity = 72/86 (83.72%), Postives = 78/86 (90.70%), Query Frame = 1
BLAST of Cp4.1LG09g02650 vs. TrEMBL
Match: A0A067K2T5_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_18264 PE=4 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 4.3e-33 Identity = 60/86 (69.77%), Postives = 74/86 (86.05%), Query Frame = 1
BLAST of Cp4.1LG09g02650 vs. TrEMBL
Match: V4TH94_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10033020mg PE=3 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 4.3e-33 Identity = 60/86 (69.77%), Postives = 75/86 (87.21%), Query Frame = 1
BLAST of Cp4.1LG09g02650 vs. TrEMBL
Match: A0A061EB50_THECC (Nudix hydrolase 1 OS=Theobroma cacao GN=TCM_011890 PE=4 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 6.9e-31 Identity = 58/86 (67.44%), Postives = 72/86 (83.72%), Query Frame = 1
BLAST of Cp4.1LG09g02650 vs. TrEMBL
Match: A0A0A0KV11_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G577370 PE=3 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 5.9e-30 Identity = 58/86 (67.44%), Postives = 68/86 (79.07%), Query Frame = 1
BLAST of Cp4.1LG09g02650 vs. TAIR10
Match: AT1G68760.1 (AT1G68760.1 nudix hydrolase 1) HSP 1 Score: 127.5 bits (319), Expect = 4.0e-30 Identity = 52/83 (62.65%), Postives = 66/83 (79.52%), Query Frame = 1
BLAST of Cp4.1LG09g02650 vs. NCBI nr
Match: gi|659091409|ref|XP_008446534.1| (PREDICTED: nudix hydrolase 1-like [Cucumis melo]) HSP 1 Score: 169.5 bits (428), Expect = 2.6e-39 Identity = 73/86 (84.88%), Postives = 80/86 (93.02%), Query Frame = 1
BLAST of Cp4.1LG09g02650 vs. NCBI nr
Match: gi|449434676|ref|XP_004135122.1| (PREDICTED: nudix hydrolase 1-like [Cucumis sativus]) HSP 1 Score: 167.9 bits (424), Expect = 7.6e-39 Identity = 72/86 (83.72%), Postives = 78/86 (90.70%), Query Frame = 1
BLAST of Cp4.1LG09g02650 vs. NCBI nr
Match: gi|1009170511|ref|XP_015866239.1| (PREDICTED: nudix hydrolase 1-like [Ziziphus jujuba]) HSP 1 Score: 150.2 bits (378), Expect = 1.6e-33 Identity = 63/86 (73.26%), Postives = 73/86 (84.88%), Query Frame = 1
BLAST of Cp4.1LG09g02650 vs. NCBI nr
Match: gi|1009179926|ref|XP_015871350.1| (PREDICTED: nudix hydrolase 1-like, partial [Ziziphus jujuba]) HSP 1 Score: 150.2 bits (378), Expect = 1.6e-33 Identity = 63/86 (73.26%), Postives = 73/86 (84.88%), Query Frame = 1
BLAST of Cp4.1LG09g02650 vs. NCBI nr
Match: gi|802680430|ref|XP_012082006.1| (PREDICTED: nudix hydrolase 1 [Jatropha curcas]) HSP 1 Score: 148.3 bits (373), Expect = 6.2e-33 Identity = 60/86 (69.77%), Postives = 74/86 (86.05%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |