Cp4.1LG08g05350 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTACATAAACTCTCAATCGGACGGAAAAGGACTGTATATGGTATTCTCGGTGATTTTCACCGGCGGCGAGTTCAGAGGGAGTAGTTTGGAGATTCAGGGCTCGGATTTGTTCACGTTGAAGGAAAGGGAATTTGGAGTGGTTTCCGGAACCGGTTTTTTCCGGTTCGTTAAGGGGTTTGGGATTATGCAAACCGAGAATATGGATTTGGTTCATTTGAGAGCTGTTATTAAACTCAATATTACAGTAAAACACTATTGA ATGTACATAAACTCTCAATCGGACGGAAAAGGACTGTATATGGTATTCTCGGTGATTTTCACCGGCGGCGAGTTCAGAGGGAGTAGTTTGGAGATTCAGGGCTCGGATTTGTTCACGTTGAAGGAAAGGGAATTTGGAGTGGTTTCCGGAACCGGTTTTTTCCGGTTCGTTAAGGGGTTTGGGATTATGCAAACCGAGAATATGGATTTGGTTCATTTGAGAGCTGTTATTAAACTCAATATTACAGTAAAACACTATTGA ATGTACATAAACTCTCAATCGGACGGAAAAGGACTGTATATGGTATTCTCGGTGATTTTCACCGGCGGCGAGTTCAGAGGGAGTAGTTTGGAGATTCAGGGCTCGGATTTGTTCACGTTGAAGGAAAGGGAATTTGGAGTGGTTTCCGGAACCGGTTTTTTCCGGTTCGTTAAGGGGTTTGGGATTATGCAAACCGAGAATATGGATTTGGTTCATTTGAGAGCTGTTATTAAACTCAATATTACAGTAAAACACTATTGA MYINSQSDGKGLYMVFSVIFTGGEFRGSSLEIQGSDLFTLKEREFGVVSGTGFFRFVKGFGIMQTENMDLVHLRAVIKLNITVKHY
BLAST of Cp4.1LG08g05350 vs. Swiss-Prot
Match: DIR11_ARATH (Dirigent protein 11 OS=Arabidopsis thaliana GN=DIR11 PE=2 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 2.2e-09 Identity = 30/85 (35.29%), Postives = 52/85 (61.18%), Query Frame = 1
BLAST of Cp4.1LG08g05350 vs. Swiss-Prot
Match: DIR17_ARATH (Dirigent protein 17 OS=Arabidopsis thaliana GN=DIR17 PE=2 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 1.8e-08 Identity = 28/85 (32.94%), Postives = 48/85 (56.47%), Query Frame = 1
BLAST of Cp4.1LG08g05350 vs. Swiss-Prot
Match: DIR4_ARATH (Dirigent protein 4 OS=Arabidopsis thaliana GN=DIR4 PE=2 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 1.8e-08 Identity = 31/86 (36.05%), Postives = 47/86 (54.65%), Query Frame = 1
BLAST of Cp4.1LG08g05350 vs. Swiss-Prot
Match: DIR1_ARATH (Dirigent protein 1 OS=Arabidopsis thaliana GN=DIR1 PE=2 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 3.1e-08 Identity = 30/85 (35.29%), Postives = 49/85 (57.65%), Query Frame = 1
BLAST of Cp4.1LG08g05350 vs. Swiss-Prot
Match: DIR21_ARATH (Dirigent protein 21 OS=Arabidopsis thaliana GN=DIR21 PE=3 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 5.3e-08 Identity = 27/85 (31.76%), Postives = 50/85 (58.82%), Query Frame = 1
BLAST of Cp4.1LG08g05350 vs. TrEMBL
Match: A0A0A0L5X2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G166330 PE=4 SV=1) HSP 1 Score: 165.6 bits (418), Expect = 2.6e-38 Identity = 81/86 (94.19%), Postives = 84/86 (97.67%), Query Frame = 1
BLAST of Cp4.1LG08g05350 vs. TrEMBL
Match: A0A0L9TSA5_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan01g298600 PE=4 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 1.1e-33 Identity = 70/86 (81.40%), Postives = 81/86 (94.19%), Query Frame = 1
BLAST of Cp4.1LG08g05350 vs. TrEMBL
Match: A0A0S3R992_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.01G513600 PE=4 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 1.1e-33 Identity = 70/86 (81.40%), Postives = 81/86 (94.19%), Query Frame = 1
BLAST of Cp4.1LG08g05350 vs. TrEMBL
Match: A0A0B2P5N6_GLYSO (Disease resistance response protein 206 OS=Glycine soja GN=glysoja_009760 PE=4 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 5.7e-33 Identity = 69/86 (80.23%), Postives = 80/86 (93.02%), Query Frame = 1
BLAST of Cp4.1LG08g05350 vs. TrEMBL
Match: I1KMR1_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_07G239900 PE=4 SV=2) HSP 1 Score: 147.9 bits (372), Expect = 5.7e-33 Identity = 69/86 (80.23%), Postives = 80/86 (93.02%), Query Frame = 1
BLAST of Cp4.1LG08g05350 vs. TAIR10
Match: AT1G22900.1 (AT1G22900.1 Disease resistance-responsive (dirigent-like protein) family protein) HSP 1 Score: 62.8 bits (151), Expect = 1.2e-10 Identity = 30/85 (35.29%), Postives = 52/85 (61.18%), Query Frame = 1
BLAST of Cp4.1LG08g05350 vs. TAIR10
Match: AT2G21110.1 (AT2G21110.1 Disease resistance-responsive (dirigent-like protein) family protein) HSP 1 Score: 59.7 bits (143), Expect = 1.0e-09 Identity = 31/86 (36.05%), Postives = 47/86 (54.65%), Query Frame = 1
BLAST of Cp4.1LG08g05350 vs. TAIR10
Match: AT3G58090.1 (AT3G58090.1 Disease resistance-responsive (dirigent-like protein) family protein) HSP 1 Score: 59.7 bits (143), Expect = 1.0e-09 Identity = 28/85 (32.94%), Postives = 48/85 (56.47%), Query Frame = 1
BLAST of Cp4.1LG08g05350 vs. TAIR10
Match: AT5G42510.1 (AT5G42510.1 Disease resistance-responsive (dirigent-like protein) family protein) HSP 1 Score: 58.9 bits (141), Expect = 1.7e-09 Identity = 30/85 (35.29%), Postives = 49/85 (57.65%), Query Frame = 1
BLAST of Cp4.1LG08g05350 vs. TAIR10
Match: AT1G65870.1 (AT1G65870.1 Disease resistance-responsive (dirigent-like protein) family protein) HSP 1 Score: 58.2 bits (139), Expect = 3.0e-09 Identity = 27/85 (31.76%), Postives = 50/85 (58.82%), Query Frame = 1
BLAST of Cp4.1LG08g05350 vs. NCBI nr
Match: gi|449432918|ref|XP_004134245.1| (PREDICTED: dirigent protein 11-like [Cucumis sativus]) HSP 1 Score: 165.6 bits (418), Expect = 3.8e-38 Identity = 81/86 (94.19%), Postives = 84/86 (97.67%), Query Frame = 1
BLAST of Cp4.1LG08g05350 vs. NCBI nr
Match: gi|659076950|ref|XP_008438952.1| (PREDICTED: dirigent protein 11-like [Cucumis melo]) HSP 1 Score: 161.4 bits (407), Expect = 7.1e-37 Identity = 79/86 (91.86%), Postives = 84/86 (97.67%), Query Frame = 1
BLAST of Cp4.1LG08g05350 vs. NCBI nr
Match: gi|920689447|gb|KOM33430.1| (hypothetical protein LR48_Vigan01g298600 [Vigna angularis]) HSP 1 Score: 150.2 bits (378), Expect = 1.6e-33 Identity = 70/86 (81.40%), Postives = 81/86 (94.19%), Query Frame = 1
BLAST of Cp4.1LG08g05350 vs. NCBI nr
Match: gi|951006408|ref|XP_014508461.1| (PREDICTED: dirigent protein 11-like [Vigna radiata var. radiata]) HSP 1 Score: 147.9 bits (372), Expect = 8.1e-33 Identity = 69/86 (80.23%), Postives = 80/86 (93.02%), Query Frame = 1
BLAST of Cp4.1LG08g05350 vs. NCBI nr
Match: gi|734318091|gb|KHN02894.1| (Disease resistance response protein 206 [Glycine soja]) HSP 1 Score: 147.9 bits (372), Expect = 8.1e-33 Identity = 69/86 (80.23%), Postives = 80/86 (93.02%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|