Cp4.1LG07g02330 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCACAATCTATCTCCTAACAACATTCCCACCACCACCACCACCACCGACGACGCTTCCGACGCCTCCGATGAACTCACCGAAATCGTCCAGCTTCCCTCTCTCGGCACCGCCTACGACGGCGACTGCGGCGACTCCTTCGTTTTCCTCGACTACTCAACAGAGGATTCCGCCGCCTGGCTTTACCCACCGCCGTGGCTACCATCTCTCGAGGATTACGATGAAATTCAAAACGACGGTAAGATGGGAATGGGAATGGGATTCATTTCCACCAATTTCAAAGGATTATTGTGGGATTATTAA ATGCACAATCTATCTCCTAACAACATTCCCACCACCACCACCACCACCGACGACGCTTCCGACGCCTCCGATGAACTCACCGAAATCGTCCAGCTTCCCTCTCTCGGCACCGCCTACGACGGCGACTGCGGCGACTCCTTCGTTTTCCTCGACTACTCAACAGAGGATTCCGCCGCCTGGCTTTACCCACCGCCGTGGCTACCATCTCTCGAGGATTACGATGAAATTCAAAACGACGGTAAGATGGGAATGGGAATGGGATTCATTTCCACCAATTTCAAAGGATTATTGTGGGATTATTAA ATGCACAATCTATCTCCTAACAACATTCCCACCACCACCACCACCACCGACGACGCTTCCGACGCCTCCGATGAACTCACCGAAATCGTCCAGCTTCCCTCTCTCGGCACCGCCTACGACGGCGACTGCGGCGACTCCTTCGTTTTCCTCGACTACTCAACAGAGGATTCCGCCGCCTGGCTTTACCCACCGCCGTGGCTACCATCTCTCGAGGATTACGATGAAATTCAAAACGACGGTAAGATGGGAATGGGAATGGGATTCATTTCCACCAATTTCAAAGGATTATTGTGGGATTATTAA MHNLSPNNIPTTTTTTDDASDASDELTEIVQLPSLGTAYDGDCGDSFVFLDYSTEDSAAWLYPPPWLPSLEDYDEIQNDGKMGMGMGFISTNFKGLLWDY
BLAST of Cp4.1LG07g02330 vs. TrEMBL
Match: Q75UJ6_CUCME (DREB-like protein OS=Cucumis melo GN=CMe-DREB1 PE=2 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 4.9e-20 Identity = 59/105 (56.19%), Postives = 74/105 (70.48%), Query Frame = 1
BLAST of Cp4.1LG07g02330 vs. TrEMBL
Match: A0A0A0LPS6_CUCSA (DREB-like protein OS=Cucumis sativus GN=Csa_2G374590 PE=4 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 4.1e-19 Identity = 58/105 (55.24%), Postives = 73/105 (69.52%), Query Frame = 1
BLAST of Cp4.1LG07g02330 vs. TrEMBL
Match: W6FFW1_9ROSA (Dehydration responsive element binding transcription factor OS=Morus notabilis GN=DREB4D PE=2 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 2.3e-09 Identity = 47/117 (40.17%), Postives = 62/117 (52.99%), Query Frame = 1
BLAST of Cp4.1LG07g02330 vs. TrEMBL
Match: A0A0D2Q9A2_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G050200 PE=4 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 1.1e-08 Identity = 33/62 (53.23%), Postives = 41/62 (66.13%), Query Frame = 1
BLAST of Cp4.1LG07g02330 vs. TrEMBL
Match: A0A067KPE2_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_07721 PE=4 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 3.6e-07 Identity = 40/105 (38.10%), Postives = 62/105 (59.05%), Query Frame = 1
BLAST of Cp4.1LG07g02330 vs. TAIR10
Match: AT5G11590.1 (AT5G11590.1 Integrase-type DNA-binding superfamily protein) HSP 1 Score: 49.3 bits (116), Expect = 1.6e-06 Identity = 41/99 (41.41%), Postives = 51/99 (51.52%), Query Frame = 1
BLAST of Cp4.1LG07g02330 vs. TAIR10
Match: AT5G25810.1 (AT5G25810.1 Integrase-type DNA-binding superfamily protein) HSP 1 Score: 47.0 bits (110), Expect = 8.0e-06 Identity = 27/60 (45.00%), Postives = 36/60 (60.00%), Query Frame = 1
BLAST of Cp4.1LG07g02330 vs. NCBI nr
Match: gi|985482321|ref|NP_001306241.1| (ethylene-responsive transcription factor TINY-like [Cucumis melo]) HSP 1 Score: 105.1 bits (261), Expect = 7.0e-20 Identity = 59/105 (56.19%), Postives = 74/105 (70.48%), Query Frame = 1
BLAST of Cp4.1LG07g02330 vs. NCBI nr
Match: gi|778672054|ref|XP_004150289.2| (PREDICTED: ethylene-responsive transcription factor TINY-like [Cucumis sativus]) HSP 1 Score: 102.1 bits (253), Expect = 5.9e-19 Identity = 58/105 (55.24%), Postives = 73/105 (69.52%), Query Frame = 1
BLAST of Cp4.1LG07g02330 vs. NCBI nr
Match: gi|823229144|ref|XP_012447312.1| (PREDICTED: ethylene-responsive transcription factor TINY-like [Gossypium raimondii]) HSP 1 Score: 76.6 bits (187), Expect = 2.7e-11 Identity = 41/85 (48.24%), Postives = 53/85 (62.35%), Query Frame = 1
BLAST of Cp4.1LG07g02330 vs. NCBI nr
Match: gi|470109809|ref|XP_004291182.1| (PREDICTED: dehydration-responsive element-binding protein 3-like [Fragaria vesca subsp. vesca]) HSP 1 Score: 70.9 bits (172), Expect = 1.5e-09 Identity = 40/97 (41.24%), Postives = 61/97 (62.89%), Query Frame = 1
BLAST of Cp4.1LG07g02330 vs. NCBI nr
Match: gi|703121669|ref|XP_010102390.1| (Dehydration-responsive element-binding protein 3 [Morus notabilis]) HSP 1 Score: 69.7 bits (169), Expect = 3.3e-09 Identity = 47/117 (40.17%), Postives = 62/117 (52.99%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|