Cp4.1LG05g08210 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTAGAGGCACGTCTCAATCCCAATCCGCATCATCCTCCACCTCCAGGCCTGGCGTTGTGGCTCCTCGCGGCTCCGCGGCGGCGACGGCTGGTCTTCGCCGTCGCCGTCTCGGCTCCACTTCTGGTGCCGGCACCACTGGACTTGTTTCTGGCGGATCAAGTGGCGGCGGCAACATGCTGAGGTTCTACACTGACGATGCTCCTGGTTTGAAGATTTCTCCGACCGTCGTCCTCGTCGTGAGCCTCTGCTTCATCGGCTTCGTCACTGGCCTCCACGTCTTCGGTAAGCTCTATCGCGCGCGATCCGCCGCGGGAGTTTAA ATGGCTAGAGGCACGTCTCAATCCCAATCCGCATCATCCTCCACCTCCAGGCCTGGCGTTGTGGCTCCTCGCGGCTCCGCGGCGGCGACGGCTGGTCTTCGCCGTCGCCGTCTCGGCTCCACTTCTGGTGCCGGCACCACTGGACTTGTTTCTGGCGGATCAAGTGGCGGCGGCAACATGCTGAGGTTCTACACTGACGATGCTCCTGGTTTGAAGATTTCTCCGACCGTCGTCCTCGTCGTGAGCCTCTGCTTCATCGGCTTCGTCACTGGCCTCCACGTCTTCGGTAAGCTCTATCGCGCGCGATCCGCCGCGGGAGTTTAA ATGGCTAGAGGCACGTCTCAATCCCAATCCGCATCATCCTCCACCTCCAGGCCTGGCGTTGTGGCTCCTCGCGGCTCCGCGGCGGCGACGGCTGGTCTTCGCCGTCGCCGTCTCGGCTCCACTTCTGGTGCCGGCACCACTGGACTTGTTTCTGGCGGATCAAGTGGCGGCGGCAACATGCTGAGGTTCTACACTGACGATGCTCCTGGTTTGAAGATTTCTCCGACCGTCGTCCTCGTCGTGAGCCTCTGCTTCATCGGCTTCGTCACTGGCCTCCACGTCTTCGGTAAGCTCTATCGCGCGCGATCCGCCGCGGGAGTTTAA MARGTSQSQSASSSTSRPGVVAPRGSAAATAGLRRRRLGSTSGAGTTGLVSGGSSGGGNMLRFYTDDAPGLKISPTVVLVVSLCFIGFVTGLHVFGKLYRARSAAGV
BLAST of Cp4.1LG05g08210 vs. Swiss-Prot
Match: SC61B_ARATH (Protein transport protein Sec61 subunit beta OS=Arabidopsis thaliana GN=At2g45070 PE=1 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 8.6e-16 Identity = 52/78 (66.67%), Postives = 60/78 (76.92%), Query Frame = 1
BLAST of Cp4.1LG05g08210 vs. Swiss-Prot
Match: SC61B_DICDI (Protein transport protein Sec61 subunit beta OS=Dictyostelium discoideum GN=sec61b PE=3 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 4.3e-07 Identity = 25/48 (52.08%), Postives = 35/48 (72.92%), Query Frame = 1
BLAST of Cp4.1LG05g08210 vs. Swiss-Prot
Match: SC61B_PONAB (Protein transport protein Sec61 subunit beta OS=Pongo abelii GN=SEC61B PE=3 SV=3) HSP 1 Score: 51.2 bits (121), Expect = 8.1e-06 Identity = 38/97 (39.18%), Postives = 50/97 (51.55%), Query Frame = 1
BLAST of Cp4.1LG05g08210 vs. Swiss-Prot
Match: SC61B_MOUSE (Protein transport protein Sec61 subunit beta OS=Mus musculus GN=Sec61b PE=1 SV=3) HSP 1 Score: 51.2 bits (121), Expect = 8.1e-06 Identity = 38/97 (39.18%), Postives = 50/97 (51.55%), Query Frame = 1
BLAST of Cp4.1LG05g08210 vs. Swiss-Prot
Match: SC61B_HUMAN (Protein transport protein Sec61 subunit beta OS=Homo sapiens GN=SEC61B PE=1 SV=2) HSP 1 Score: 51.2 bits (121), Expect = 8.1e-06 Identity = 38/97 (39.18%), Postives = 50/97 (51.55%), Query Frame = 1
BLAST of Cp4.1LG05g08210 vs. TrEMBL
Match: A0A0A0KHR1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G293930 PE=4 SV=1) HSP 1 Score: 172.2 bits (435), Expect = 3.5e-40 Identity = 96/109 (88.07%), Postives = 102/109 (93.58%), Query Frame = 1
BLAST of Cp4.1LG05g08210 vs. TrEMBL
Match: M5W0W7_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa013697mg PE=4 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 7.0e-33 Identity = 82/107 (76.64%), Postives = 92/107 (85.98%), Query Frame = 1
BLAST of Cp4.1LG05g08210 vs. TrEMBL
Match: V7AH75_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_003G173500g PE=4 SV=1) HSP 1 Score: 146.4 bits (368), Expect = 2.0e-32 Identity = 84/108 (77.78%), Postives = 93/108 (86.11%), Query Frame = 1
BLAST of Cp4.1LG05g08210 vs. TrEMBL
Match: B9SK56_RICCO (Protein transport protein Sec61 subunit beta, putative OS=Ricinus communis GN=RCOM_1401130 PE=4 SV=1) HSP 1 Score: 143.7 bits (361), Expect = 1.3e-31 Identity = 81/104 (77.88%), Postives = 88/104 (84.62%), Query Frame = 1
BLAST of Cp4.1LG05g08210 vs. TrEMBL
Match: Q2HSW3_MEDTR (Protein transporter Sec61 subunit beta-like protein OS=Medicago truncatula GN=MTR_2g093770 PE=4 SV=1) HSP 1 Score: 142.5 bits (358), Expect = 3.0e-31 Identity = 83/110 (75.45%), Postives = 94/110 (85.45%), Query Frame = 1
BLAST of Cp4.1LG05g08210 vs. TAIR10
Match: AT5G60460.1 (AT5G60460.1 Preprotein translocase Sec, Sec61-beta subunit protein) HSP 1 Score: 131.3 bits (329), Expect = 3.5e-31 Identity = 77/108 (71.30%), Postives = 86/108 (79.63%), Query Frame = 1
BLAST of Cp4.1LG05g08210 vs. TAIR10
Match: AT2G45070.1 (AT2G45070.1 Preprotein translocase Sec, Sec61-beta subunit protein) HSP 1 Score: 84.3 bits (207), Expect = 4.8e-17 Identity = 52/78 (66.67%), Postives = 60/78 (76.92%), Query Frame = 1
BLAST of Cp4.1LG05g08210 vs. TAIR10
Match: AT3G60540.1 (AT3G60540.1 Preprotein translocase Sec, Sec61-beta subunit protein) HSP 1 Score: 80.1 bits (196), Expect = 9.1e-16 Identity = 49/86 (56.98%), Postives = 57/86 (66.28%), Query Frame = 1
BLAST of Cp4.1LG05g08210 vs. NCBI nr
Match: gi|449463643|ref|XP_004149541.1| (PREDICTED: protein transport protein Sec61 subunit beta [Cucumis sativus]) HSP 1 Score: 172.2 bits (435), Expect = 5.0e-40 Identity = 96/109 (88.07%), Postives = 102/109 (93.58%), Query Frame = 1
BLAST of Cp4.1LG05g08210 vs. NCBI nr
Match: gi|659127865|ref|XP_008463929.1| (PREDICTED: protein transport protein Sec61 subunit beta [Cucumis melo]) HSP 1 Score: 171.8 bits (434), Expect = 6.5e-40 Identity = 96/109 (88.07%), Postives = 101/109 (92.66%), Query Frame = 1
BLAST of Cp4.1LG05g08210 vs. NCBI nr
Match: gi|702476327|ref|XP_010032019.1| (PREDICTED: protein transport protein Sec61 subunit beta [Eucalyptus grandis]) HSP 1 Score: 148.3 bits (373), Expect = 7.7e-33 Identity = 83/111 (74.77%), Postives = 92/111 (82.88%), Query Frame = 1
BLAST of Cp4.1LG05g08210 vs. NCBI nr
Match: gi|595830955|ref|XP_007206170.1| (hypothetical protein PRUPE_ppa013697mg [Prunus persica]) HSP 1 Score: 147.9 bits (372), Expect = 1.0e-32 Identity = 82/107 (76.64%), Postives = 92/107 (85.98%), Query Frame = 1
BLAST of Cp4.1LG05g08210 vs. NCBI nr
Match: gi|593182035|ref|XP_007132194.1| (hypothetical protein PHAVU_011G073900g [Phaseolus vulgaris]) HSP 1 Score: 146.4 bits (368), Expect = 2.9e-32 Identity = 84/108 (77.78%), Postives = 93/108 (86.11%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|