Cp4.1LG05g05710 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGATTCTGAAAACGATCAAGCAAGACGTCGGATCCGATCTCGCCATCAGGCGGAGGAACGAGGAGCTCGAGAAGGAGCTTCAGGCGAGCCGCGAAAGAGAGCAGGTGATGCGGCAGCAGCTACAAAGAGCCTGCGAGAGGCTCAAGGTCGCCGAGGAGGCCGAAGAGAGGCTCTCCTCTCAACTCGGAGAACTCGAGGCGGAGGCGCTCACGCAGGCCCGCGATTACCACCACCAAATCGCGGCGTTGATGAACCAGCTCTCGCAGGCTCAGAAATTGCTGCAGATCCGACTGCAACAACCGCAACTCCAATCTGCCTCTGTCTAG ATGGGGATTCTGAAAACGATCAAGCAAGACGTCGGATCCGATCTCGCCATCAGGCGGAGGAACGAGGAGCTCGAGAAGGAGCTTCAGGCGAGCCGCGAAAGAGAGCAGGTGATGCGGCAGCAGCTACAAAGAGCCTGCGAGAGGCTCAAGGTCGCCGAGGAGGCCGAAGAGAGGCTCTCCTCTCAACTCGGAGAACTCGAGGCGGAGGCGCTCACGCAGGCCCGCGATTACCACCACCAAATCGCGGCGTTGATGAACCAGCTCTCGCAGGCTCAGAAATTGCTGCAGATCCGACTGCAACAACCGCAACTCCAATCTGCCTCTGTCTAG ATGGGGATTCTGAAAACGATCAAGCAAGACGTCGGATCCGATCTCGCCATCAGGCGGAGGAACGAGGAGCTCGAGAAGGAGCTTCAGGCGAGCCGCGAAAGAGAGCAGGTGATGCGGCAGCAGCTACAAAGAGCCTGCGAGAGGCTCAAGGTCGCCGAGGAGGCCGAAGAGAGGCTCTCCTCTCAACTCGGAGAACTCGAGGCGGAGGCGCTCACGCAGGCCCGCGATTACCACCACCAAATCGCGGCGTTGATGAACCAGCTCTCGCAGGCTCAGAAATTGCTGCAGATCCGACTGCAACAACCGCAACTCCAATCTGCCTCTGTCTAG MGILKTIKQDVGSDLAIRRRNEELEKELQASREREQVMRQQLQRACERLKVAEEAEERLSSQLGELEAEALTQARDYHHQIAALMNQLSQAQKLLQIRLQQPQLQSASV
BLAST of Cp4.1LG05g05710 vs. TrEMBL
Match: A0A0A0KN32_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G139070 PE=4 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 5.2e-23 Identity = 68/96 (70.83%), Postives = 80/96 (83.33%), Query Frame = 1
BLAST of Cp4.1LG05g05710 vs. TrEMBL
Match: A0A067DPV7_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g033902mg PE=4 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 2.2e-18 Identity = 55/82 (67.07%), Postives = 72/82 (87.80%), Query Frame = 1
BLAST of Cp4.1LG05g05710 vs. TrEMBL
Match: F6H7A8_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_16s0098g00600 PE=4 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 3.8e-18 Identity = 57/92 (61.96%), Postives = 76/92 (82.61%), Query Frame = 1
BLAST of Cp4.1LG05g05710 vs. TrEMBL
Match: G7J9Q1_MEDTR (Response to low sulfur protein, putative OS=Medicago truncatula GN=MTR_3g093400 PE=2 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 6.5e-18 Identity = 57/81 (70.37%), Postives = 71/81 (87.65%), Query Frame = 1
BLAST of Cp4.1LG05g05710 vs. TrEMBL
Match: I1KB44_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_06G139300 PE=4 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.9e-17 Identity = 56/85 (65.88%), Postives = 73/85 (85.88%), Query Frame = 1
BLAST of Cp4.1LG05g05710 vs. TAIR10
Match: AT5G24660.1 (AT5G24660.1 response to low sulfur 2) HSP 1 Score: 60.5 bits (145), Expect = 7.6e-10 Identity = 38/74 (51.35%), Postives = 53/74 (71.62%), Query Frame = 1
BLAST of Cp4.1LG05g05710 vs. TAIR10
Match: AT3G49570.1 (AT3G49570.1 response to low sulfur 3) HSP 1 Score: 60.1 bits (144), Expect = 1.0e-09 Identity = 38/74 (51.35%), Postives = 52/74 (70.27%), Query Frame = 1
BLAST of Cp4.1LG05g05710 vs. TAIR10
Match: AT5G24655.1 (AT5G24655.1 response to low sulfur 4) HSP 1 Score: 56.6 bits (135), Expect = 1.1e-08 Identity = 37/74 (50.00%), Postives = 51/74 (68.92%), Query Frame = 1
BLAST of Cp4.1LG05g05710 vs. TAIR10
Match: AT3G49580.1 (AT3G49580.1 response to low sulfur 1) HSP 1 Score: 53.1 bits (126), Expect = 1.2e-07 Identity = 35/74 (47.30%), Postives = 50/74 (67.57%), Query Frame = 1
BLAST of Cp4.1LG05g05710 vs. NCBI nr
Match: gi|659074540|ref|XP_008437659.1| (PREDICTED: uncharacterized protein LOC103482998 [Cucumis melo]) HSP 1 Score: 115.5 bits (288), Expect = 5.7e-23 Identity = 69/96 (71.88%), Postives = 81/96 (84.38%), Query Frame = 1
BLAST of Cp4.1LG05g05710 vs. NCBI nr
Match: gi|778698698|ref|XP_011654590.1| (PREDICTED: uncharacterized protein LOC105435419 [Cucumis sativus]) HSP 1 Score: 115.2 bits (287), Expect = 7.4e-23 Identity = 68/96 (70.83%), Postives = 80/96 (83.33%), Query Frame = 1
BLAST of Cp4.1LG05g05710 vs. NCBI nr
Match: gi|985471068|ref|XP_015381147.1| (PREDICTED: uncharacterized protein LOC102628505 [Citrus sinensis]) HSP 1 Score: 99.8 bits (247), Expect = 3.2e-18 Identity = 55/82 (67.07%), Postives = 72/82 (87.80%), Query Frame = 1
BLAST of Cp4.1LG05g05710 vs. NCBI nr
Match: gi|731424634|ref|XP_002269666.3| (PREDICTED: MAP7 domain-containing protein 1-like [Vitis vinifera]) HSP 1 Score: 99.0 bits (245), Expect = 5.5e-18 Identity = 57/92 (61.96%), Postives = 76/92 (82.61%), Query Frame = 1
BLAST of Cp4.1LG05g05710 vs. NCBI nr
Match: gi|357464321|ref|XP_003602442.1| (response to low sulfur protein, putative [Medicago truncatula]) HSP 1 Score: 98.2 bits (243), Expect = 9.4e-18 Identity = 57/81 (70.37%), Postives = 71/81 (87.65%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|