Cp4.1LG04g07740 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAATCGAGCCGTTTTGCGCCAAGTATCGTGACTTACAATTCATTGATATCAGCTTTTGCACGGGACGGTTTGTTAGATGAAGCTATGGAGCTAAAAAGACAGATGGTGGAGAAGGGGATCGAGCCTGATGTTTTTACTTACACGACGTTGTTGTCTGGTTTTGAGAAGACGGGAAAGGACGATTGTGCGATGAGAGTATTTGATGAGATGAGTTGCAGGGTGCCAACTGAATATATGCGCATTCAATGTGTTGATTAA ATGGAATCGAGCCGTTTTGCGCCAAGTATCGTGACTTACAATTCATTGATATCAGCTTTTGCACGGGACGGTTTGTTAGATGAAGCTATGGAGCTAAAAAGACAGATGGTGGAGAAGGGGATCGAGCCTGATGTTTTTACTTACACGACGTTGTTGTCTGGTTTTGAGAAGACGGGAAAGGACGATTGTGCGATGAGAGTATTTGATGAGATGAGTTGCAGGGTGCCAACTGAATATATGCGCATTCAATGTGTTGATTAA ATGGAATCGAGCCGTTTTGCGCCAAGTATCGTGACTTACAATTCATTGATATCAGCTTTTGCACGGGACGGTTTGTTAGATGAAGCTATGGAGCTAAAAAGACAGATGGTGGAGAAGGGGATCGAGCCTGATGTTTTTACTTACACGACGTTGTTGTCTGGTTTTGAGAAGACGGGAAAGGACGATTGTGCGATGAGAGTATTTGATGAGATGAGTTGCAGGGTGCCAACTGAATATATGCGCATTCAATGTGTTGATTAA MESSRFAPSIVTYNSLISAFARDGLLDEAMELKRQMVEKGIEPDVFTYTTLLSGFEKTGKDDCAMRVFDEMSCRVPTEYMRIQCVD
BLAST of Cp4.1LG04g07740 vs. Swiss-Prot
Match: PP362_ARATH (Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 3.4e-23 Identity = 51/66 (77.27%), Postives = 59/66 (89.39%), Query Frame = 1
BLAST of Cp4.1LG04g07740 vs. Swiss-Prot
Match: PP360_ARATH (Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 6.7e-11 Identity = 33/64 (51.56%), Postives = 43/64 (67.19%), Query Frame = 1
BLAST of Cp4.1LG04g07740 vs. Swiss-Prot
Match: PPR56_ARATH (Pentatricopeptide repeat-containing protein At1g22960, mitochondrial OS=Arabidopsis thaliana GN=At1g22960 PE=2 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 2.5e-10 Identity = 33/64 (51.56%), Postives = 39/64 (60.94%), Query Frame = 1
BLAST of Cp4.1LG04g07740 vs. Swiss-Prot
Match: PP412_ARATH (Pentatricopeptide repeat-containing protein At5g41170, mitochondrial OS=Arabidopsis thaliana GN=At5g41170 PE=2 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 3.3e-10 Identity = 33/66 (50.00%), Postives = 44/66 (66.67%), Query Frame = 1
BLAST of Cp4.1LG04g07740 vs. Swiss-Prot
Match: PPR39_ARATH (Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana GN=At1g12775 PE=2 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 5.7e-10 Identity = 27/68 (39.71%), Postives = 45/68 (66.18%), Query Frame = 1
BLAST of Cp4.1LG04g07740 vs. TrEMBL
Match: A0A0A0K4H7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G071530 PE=4 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 1.8e-26 Identity = 62/71 (87.32%), Postives = 68/71 (95.77%), Query Frame = 1
BLAST of Cp4.1LG04g07740 vs. TrEMBL
Match: A0A059AN63_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_I01083 PE=4 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 3.7e-24 Identity = 58/71 (81.69%), Postives = 63/71 (88.73%), Query Frame = 1
BLAST of Cp4.1LG04g07740 vs. TrEMBL
Match: B9RY68_RICCO (Pentatricopeptide repeat-containing protein, putative OS=Ricinus communis GN=RCOM_0810720 PE=4 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 3.1e-23 Identity = 58/71 (81.69%), Postives = 63/71 (88.73%), Query Frame = 1
BLAST of Cp4.1LG04g07740 vs. TrEMBL
Match: A0A068TMN6_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00014524001 PE=4 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 4.1e-23 Identity = 55/71 (77.46%), Postives = 64/71 (90.14%), Query Frame = 1
BLAST of Cp4.1LG04g07740 vs. TrEMBL
Match: M1CFP0_SOLTU (Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400025851 PE=4 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 4.1e-23 Identity = 53/72 (73.61%), Postives = 65/72 (90.28%), Query Frame = 1
BLAST of Cp4.1LG04g07740 vs. TAIR10
Match: AT5G02860.1 (AT5G02860.1 Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 108.6 bits (270), Expect = 1.9e-24 Identity = 51/66 (77.27%), Postives = 59/66 (89.39%), Query Frame = 1
BLAST of Cp4.1LG04g07740 vs. TAIR10
Match: AT5G01110.1 (AT5G01110.1 Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 67.8 bits (164), Expect = 3.8e-12 Identity = 33/64 (51.56%), Postives = 43/64 (67.19%), Query Frame = 1
BLAST of Cp4.1LG04g07740 vs. TAIR10
Match: AT1G22960.1 (AT1G22960.1 Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 65.9 bits (159), Expect = 1.4e-11 Identity = 33/64 (51.56%), Postives = 39/64 (60.94%), Query Frame = 1
BLAST of Cp4.1LG04g07740 vs. TAIR10
Match: AT5G41170.1 (AT5G41170.1 Pentatricopeptide repeat (PPR-like) superfamily protein) HSP 1 Score: 65.5 bits (158), Expect = 1.9e-11 Identity = 33/66 (50.00%), Postives = 44/66 (66.67%), Query Frame = 1
BLAST of Cp4.1LG04g07740 vs. TAIR10
Match: AT1G12775.1 (AT1G12775.1 Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 64.7 bits (156), Expect = 3.2e-11 Identity = 27/68 (39.71%), Postives = 45/68 (66.18%), Query Frame = 1
BLAST of Cp4.1LG04g07740 vs. NCBI nr
Match: gi|449438627|ref|XP_004137089.1| (PREDICTED: pentatricopeptide repeat-containing protein At5g02860 [Cucumis sativus]) HSP 1 Score: 126.3 bits (316), Expect = 2.5e-26 Identity = 62/71 (87.32%), Postives = 68/71 (95.77%), Query Frame = 1
BLAST of Cp4.1LG04g07740 vs. NCBI nr
Match: gi|700188631|gb|KGN43864.1| (hypothetical protein Csa_7G071530 [Cucumis sativus]) HSP 1 Score: 126.3 bits (316), Expect = 2.5e-26 Identity = 62/71 (87.32%), Postives = 68/71 (95.77%), Query Frame = 1
BLAST of Cp4.1LG04g07740 vs. NCBI nr
Match: gi|659110047|ref|XP_008455020.1| (PREDICTED: pentatricopeptide repeat-containing protein At5g02860 [Cucumis melo]) HSP 1 Score: 125.9 bits (315), Expect = 3.3e-26 Identity = 62/71 (87.32%), Postives = 68/71 (95.77%), Query Frame = 1
BLAST of Cp4.1LG04g07740 vs. NCBI nr
Match: gi|702462301|ref|XP_010028382.1| (PREDICTED: pentatricopeptide repeat-containing protein At5g02860 isoform X1 [Eucalyptus grandis]) HSP 1 Score: 118.6 bits (296), Expect = 5.3e-24 Identity = 58/71 (81.69%), Postives = 63/71 (88.73%), Query Frame = 1
BLAST of Cp4.1LG04g07740 vs. NCBI nr
Match: gi|702462305|ref|XP_010028383.1| (PREDICTED: pentatricopeptide repeat-containing protein At5g02860 isoform X2 [Eucalyptus grandis]) HSP 1 Score: 118.6 bits (296), Expect = 5.3e-24 Identity = 58/71 (81.69%), Postives = 63/71 (88.73%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |