Cp4.1LG01g25550 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACTCCATGGATCGCTCTCGAGCTTTCCTTCGGGATGTCAAGCGCCTGGTTGTCAAGGTACCTCTCATTTCAACCACATTTTCATGTTTCCCGATGTTCTTTTTTTATTCCTTTATTTTTTTTTTGTGGTTTTCATTCTGTTTGAGCTTTATATTCTTCGTTCTCATCAATGTTTGCCGATTTGGATTCCCTCTGTGTGTTGCAACTTCTCCTCAGTTCATCCTACTGGAAAACCACGTGCAGATTATCTCAATTTTGGATCATCAAACCGTTGATAATATAATTTACTTACCTGTTATTGGATGTTGTGCTTTTCTTATTGAAGGTTGGGACGGCGGTGGTAACGCGAAGTGATGGAAGATTAGCCTTAGGCAGACTAGGAGCATTGTGTGAGCAGGTATTTACCTTGCACGCTCAAGTTCAATCTTTTGATAGTGATAGGACTTTTTTTTTTTTTTTTTTTTAATATTAAGATTACAATCTGGAATGCAGATCAAGGAACTTAACTCCCAAGAATACGAGGTTATTTTGGTTTCATCCGGTGCTGTTGGCATTGGTCGTCAAAGGCTCCGATACAGGAAGCTCGTTAATAGCAGGTTATTTTGTGCGGGATAA ATGGACTCCATGGATCGCTCTCGAGCTTTCCTTCGGGATGTCAAGCGCCTGGTTGTCAAGGTTGGGACGGCGGTGGTAACGCGAAGTGATGGAAGATTAGCCTTAGGCAGACTAGGAGCATTGTGTGAGCAGATCAAGGAACTTAACTCCCAAGAATACGAGGTTATTTTGGTTTCATCCGGTGCTGTTGGCATTGGTCGTCAAAGGCTCCGATACAGGAAGCTCGTTAATAGCAGGTTATTTTGTGCGGGATAA ATGGACTCCATGGATCGCTCTCGAGCTTTCCTTCGGGATGTCAAGCGCCTGGTTGTCAAGGTTGGGACGGCGGTGGTAACGCGAAGTGATGGAAGATTAGCCTTAGGCAGACTAGGAGCATTGTGTGAGCAGATCAAGGAACTTAACTCCCAAGAATACGAGGTTATTTTGGTTTCATCCGGTGCTGTTGGCATTGGTCGTCAAAGGCTCCGATACAGGAAGCTCGTTAATAGCAGGTTATTTTGTGCGGGATAA MDSMDRSRAFLRDVKRLVVKVGTAVVTRSDGRLALGRLGALCEQIKELNSQEYEVILVSSGAVGIGRQRLRYRKLVNSRLFCAG
BLAST of Cp4.1LG01g25550 vs. Swiss-Prot
Match: P5CS_SOLLC (Delta-1-pyrroline-5-carboxylate synthase OS=Solanum lycopersicum GN=PRO2 PE=2 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 2.4e-29 Identity = 62/78 (79.49%), Postives = 76/78 (97.44%), Query Frame = 1
BLAST of Cp4.1LG01g25550 vs. Swiss-Prot
Match: P5CS_ACTDE (Delta-1-pyrroline-5-carboxylate synthase OS=Actinidia deliciosa PE=2 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 5.3e-29 Identity = 62/78 (79.49%), Postives = 74/78 (94.87%), Query Frame = 1
BLAST of Cp4.1LG01g25550 vs. Swiss-Prot
Match: P5CS_ORYSJ (Delta-1-pyrroline-5-carboxylate synthase OS=Oryza sativa subsp. japonica GN=P5CS PE=2 SV=2) HSP 1 Score: 127.1 bits (318), Expect = 9.1e-29 Identity = 62/78 (79.49%), Postives = 73/78 (93.59%), Query Frame = 1
BLAST of Cp4.1LG01g25550 vs. Swiss-Prot
Match: P5CS1_ARATH (Delta-1-pyrroline-5-carboxylate synthase A OS=Arabidopsis thaliana GN=P5CSA PE=1 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 4.5e-28 Identity = 63/78 (80.77%), Postives = 70/78 (89.74%), Query Frame = 1
BLAST of Cp4.1LG01g25550 vs. Swiss-Prot
Match: P5CS_MESCR (Delta-1-pyrroline-5-carboxylate synthase OS=Mesembryanthemum crystallinum GN=P5CS PE=2 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 7.7e-28 Identity = 62/75 (82.67%), Postives = 70/75 (93.33%), Query Frame = 1
BLAST of Cp4.1LG01g25550 vs. TrEMBL
Match: A0A0A0KBH3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G008780 PE=3 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 4.2e-33 Identity = 76/78 (97.44%), Postives = 77/78 (98.72%), Query Frame = 1
BLAST of Cp4.1LG01g25550 vs. TrEMBL
Match: G3M0R4_CUCME (Pyrroline-5-carboxylate synthetase OS=Cucumis melo PE=2 SV=1) HSP 1 Score: 144.8 bits (364), Expect = 4.7e-32 Identity = 75/78 (96.15%), Postives = 76/78 (97.44%), Query Frame = 1
BLAST of Cp4.1LG01g25550 vs. TrEMBL
Match: G3M3X1_9ROSI (Delta-1-pyrroline-5-carboxylate synthetase OS=Cucurbita maxima x Cucurbita moschata GN=P5CS PE=2 SV=1) HSP 1 Score: 143.7 bits (361), Expect = 1.0e-31 Identity = 74/78 (94.87%), Postives = 77/78 (98.72%), Query Frame = 1
BLAST of Cp4.1LG01g25550 vs. TrEMBL
Match: M9P0B4_CARPA (Gamma-glutamyl phosphate reductase OS=Carica papaya GN=P5CS2 PE=2 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 3.4e-30 Identity = 69/78 (88.46%), Postives = 75/78 (96.15%), Query Frame = 1
BLAST of Cp4.1LG01g25550 vs. TrEMBL
Match: A0A061ERW5_THECC (Pyrroline-5-carboxylate synthetase isoform 1 OS=Theobroma cacao GN=TCM_021858 PE=3 SV=1) HSP 1 Score: 135.6 bits (340), Expect = 2.8e-29 Identity = 67/80 (83.75%), Postives = 76/80 (95.00%), Query Frame = 1
BLAST of Cp4.1LG01g25550 vs. TAIR10
Match: AT2G39800.1 (AT2G39800.1 delta1-pyrroline-5-carboxylate synthase 1) HSP 1 Score: 124.8 bits (312), Expect = 2.5e-29 Identity = 63/78 (80.77%), Postives = 70/78 (89.74%), Query Frame = 1
BLAST of Cp4.1LG01g25550 vs. TAIR10
Match: AT3G55610.1 (AT3G55610.1 delta 1-pyrroline-5-carboxylate synthase 2) HSP 1 Score: 121.3 bits (303), Expect = 2.8e-28 Identity = 61/78 (78.21%), Postives = 69/78 (88.46%), Query Frame = 1
BLAST of Cp4.1LG01g25550 vs. NCBI nr
Match: gi|659081570|ref|XP_008441400.1| (PREDICTED: delta-1-pyrroline-5-carboxylate synthase [Cucumis melo]) HSP 1 Score: 149.8 bits (377), Expect = 2.1e-33 Identity = 77/78 (98.72%), Postives = 78/78 (100.00%), Query Frame = 1
BLAST of Cp4.1LG01g25550 vs. NCBI nr
Match: gi|449441360|ref|XP_004138450.1| (PREDICTED: delta-1-pyrroline-5-carboxylate synthase [Cucumis sativus]) HSP 1 Score: 148.3 bits (373), Expect = 6.1e-33 Identity = 76/78 (97.44%), Postives = 77/78 (98.72%), Query Frame = 1
BLAST of Cp4.1LG01g25550 vs. NCBI nr
Match: gi|346426988|gb|AEO27874.1| (pyrroline-5-carboxylate synthetase [Cucumis melo]) HSP 1 Score: 144.8 bits (364), Expect = 6.7e-32 Identity = 75/78 (96.15%), Postives = 76/78 (97.44%), Query Frame = 1
BLAST of Cp4.1LG01g25550 vs. NCBI nr
Match: gi|344310983|gb|AEN04066.1| (delta-1-pyrroline-5-carboxylate synthetase [Cucurbita maxima x Cucurbita moschata]) HSP 1 Score: 143.7 bits (361), Expect = 1.5e-31 Identity = 74/78 (94.87%), Postives = 77/78 (98.72%), Query Frame = 1
BLAST of Cp4.1LG01g25550 vs. NCBI nr
Match: gi|1009119817|ref|XP_015876587.1| (PREDICTED: delta-1-pyrroline-5-carboxylate synthase [Ziziphus jujuba]) HSP 1 Score: 138.7 bits (348), Expect = 4.8e-30 Identity = 69/78 (88.46%), Postives = 75/78 (96.15%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |