Cp4.1LG01g17590 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGGACTCAAACCGCTCCGATCATGGCTGCTTTCATTGCCACTTTCATGTTCCTCCTCGTCCTAACCAACGCTCAAAACGCCCCCCGTGACTACCTCGCGCTTCACAACCGCGCTCGAGCCAAGGTCGGTGTCGGCCCCATGCAATGGAGCAACACCGTGGCCGCGTACGCTCAAGCCTATGCGGAAAAAAGAAAGGGTGACTGTGCCATGATTCACTCAACCGGGCCGTATGGAGAAAACATAGCCGCGGGCTACTACCCTGAGTTCACCGGGGCGGATGCGGTGAAGCTGTGGGCGAACGAGAAGCCGTTGTATGATCATGCGTTGAATAAATGCGTGGGTGGTGAATGTGGGCACTACACTCAGATGGTGTGGCGGAGCTCGGTGCGGCTTGGATGTGCTAGAGTGCTCTGA ATGTGGACTCAAACCGCTCCGATCATGGCTGCTTTCATTGCCACTTTCATGTTCCTCCTCGTCCTAACCAACGCTCAAAACGCCCCCCGTGACTACCTCGCGCTTCACAACCGCGCTCGAGCCAAGGTCGGTGTCGGCCCCATGCAATGGAGCAACACCGTGGCCGCGTACGCTCAAGCCTATGCGGAAAAAAGAAAGGGTGACTGTGCCATGATTCACTCAACCGGGCCGTATGGAGAAAACATAGCCGCGGGCTACTACCCTGAGTTCACCGGGGCGGATGCGGTGAAGCTGTGGGCGAACGAGAAGCCGTTGTATGATCATGCGTTGAATAAATGCGTGGGTGGTGAATGTGGGCACTACACTCAGATGGTGTGGCGGAGCTCGGTGCGGCTTGGATGTGCTAGAGTGCTCTGA ATGTGGACTCAAACCGCTCCGATCATGGCTGCTTTCATTGCCACTTTCATGTTCCTCCTCGTCCTAACCAACGCTCAAAACGCCCCCCGTGACTACCTCGCGCTTCACAACCGCGCTCGAGCCAAGGTCGGTGTCGGCCCCATGCAATGGAGCAACACCGTGGCCGCGTACGCTCAAGCCTATGCGGAAAAAAGAAAGGGTGACTGTGCCATGATTCACTCAACCGGGCCGTATGGAGAAAACATAGCCGCGGGCTACTACCCTGAGTTCACCGGGGCGGATGCGGTGAAGCTGTGGGCGAACGAGAAGCCGTTGTATGATCATGCGTTGAATAAATGCGTGGGTGGTGAATGTGGGCACTACACTCAGATGGTGTGGCGGAGCTCGGTGCGGCTTGGATGTGCTAGAGTGCTCTGA MWTQTAPIMAAFIATFMFLLVLTNAQNAPRDYLALHNRARAKVGVGPMQWSNTVAAYAQAYAEKRKGDCAMIHSTGPYGENIAAGYYPEFTGADAVKLWANEKPLYDHALNKCVGGECGHYTQMVWRSSVRLGCARVL
BLAST of Cp4.1LG01g17590 vs. Swiss-Prot
Match: PRB1_TOBAC (Basic form of pathogenesis-related protein 1 OS=Nicotiana tabacum PE=3 SV=1) HSP 1 Score: 172.6 bits (436), Expect = 3.1e-42 Identity = 82/130 (63.08%), Postives = 98/130 (75.38%), Query Frame = 1
BLAST of Cp4.1LG01g17590 vs. Swiss-Prot
Match: PR1_ARATH (Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=At2g14610 PE=1 SV=1) HSP 1 Score: 152.1 bits (383), Expect = 4.3e-36 Identity = 71/136 (52.21%), Postives = 98/136 (72.06%), Query Frame = 1
BLAST of Cp4.1LG01g17590 vs. Swiss-Prot
Match: PR1A_SOLLC (Pathogenesis-related protein 1A1 OS=Solanum lycopersicum PE=2 SV=1) HSP 1 Score: 146.7 bits (369), Expect = 1.8e-34 Identity = 71/129 (55.04%), Postives = 91/129 (70.54%), Query Frame = 1
BLAST of Cp4.1LG01g17590 vs. Swiss-Prot
Match: PR04_SOLLC (Pathogenesis-related leaf protein 4 OS=Solanum lycopersicum PE=2 SV=1) HSP 1 Score: 145.2 bits (365), Expect = 5.3e-34 Identity = 69/113 (61.06%), Postives = 87/113 (76.99%), Query Frame = 1
BLAST of Cp4.1LG01g17590 vs. Swiss-Prot
Match: PR1A_TOBAC (Pathogenesis-related protein 1A OS=Nicotiana tabacum PE=1 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 1.2e-33 Identity = 68/129 (52.71%), Postives = 89/129 (68.99%), Query Frame = 1
BLAST of Cp4.1LG01g17590 vs. TrEMBL
Match: A0A0A0LLX7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G381130 PE=3 SV=1) HSP 1 Score: 214.5 bits (545), Expect = 7.9e-53 Identity = 95/129 (73.64%), Postives = 108/129 (83.72%), Query Frame = 1
BLAST of Cp4.1LG01g17590 vs. TrEMBL
Match: A0A0A0KHP4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G483242 PE=3 SV=1) HSP 1 Score: 211.5 bits (537), Expect = 6.7e-52 Identity = 92/121 (76.03%), Postives = 106/121 (87.60%), Query Frame = 1
BLAST of Cp4.1LG01g17590 vs. TrEMBL
Match: A0A0A0LSG5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G381380 PE=3 SV=1) HSP 1 Score: 209.5 bits (532), Expect = 2.5e-51 Identity = 93/129 (72.09%), Postives = 106/129 (82.17%), Query Frame = 1
BLAST of Cp4.1LG01g17590 vs. TrEMBL
Match: E2GEV9_9ROSI (Pathogenesis-related protein 1 OS=Vitis hybrid cultivar GN=PR-1 PE=3 SV=1) HSP 1 Score: 174.9 bits (442), Expect = 6.9e-41 Identity = 78/113 (69.03%), Postives = 91/113 (80.53%), Query Frame = 1
BLAST of Cp4.1LG01g17590 vs. TrEMBL
Match: E2GEV6_9ROSI (Pathogenesis-related protein 1 OS=Vitis hybrid cultivar GN=PR-1 PE=3 SV=1) HSP 1 Score: 172.6 bits (436), Expect = 3.4e-40 Identity = 77/113 (68.14%), Postives = 91/113 (80.53%), Query Frame = 1
BLAST of Cp4.1LG01g17590 vs. TAIR10
Match: AT1G50060.1 (AT1G50060.1 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein) HSP 1 Score: 157.1 bits (396), Expect = 7.6e-39 Identity = 72/126 (57.14%), Postives = 88/126 (69.84%), Query Frame = 1
BLAST of Cp4.1LG01g17590 vs. TAIR10
Match: AT2G14610.1 (AT2G14610.1 pathogenesis-related gene 1) HSP 1 Score: 152.1 bits (383), Expect = 2.4e-37 Identity = 71/136 (52.21%), Postives = 98/136 (72.06%), Query Frame = 1
BLAST of Cp4.1LG01g17590 vs. TAIR10
Match: AT4G33720.1 (AT4G33720.1 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein) HSP 1 Score: 147.1 bits (370), Expect = 7.8e-36 Identity = 71/126 (56.35%), Postives = 92/126 (73.02%), Query Frame = 1
BLAST of Cp4.1LG01g17590 vs. TAIR10
Match: AT1G50050.1 (AT1G50050.1 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein) HSP 1 Score: 145.6 bits (366), Expect = 2.3e-35 Identity = 71/128 (55.47%), Postives = 87/128 (67.97%), Query Frame = 1
BLAST of Cp4.1LG01g17590 vs. TAIR10
Match: AT2G14580.1 (AT2G14580.1 basic pathogenesis-related protein 1) HSP 1 Score: 142.9 bits (359), Expect = 1.5e-34 Identity = 68/130 (52.31%), Postives = 92/130 (70.77%), Query Frame = 1
BLAST of Cp4.1LG01g17590 vs. NCBI nr
Match: gi|778722387|ref|XP_011658476.1| (PREDICTED: basic form of pathogenesis-related protein 1-like [Cucumis sativus]) HSP 1 Score: 217.2 bits (552), Expect = 1.7e-53 Identity = 96/129 (74.42%), Postives = 110/129 (85.27%), Query Frame = 1
BLAST of Cp4.1LG01g17590 vs. NCBI nr
Match: gi|700207816|gb|KGN62935.1| (hypothetical protein Csa_2G381130 [Cucumis sativus]) HSP 1 Score: 214.5 bits (545), Expect = 1.1e-52 Identity = 95/129 (73.64%), Postives = 108/129 (83.72%), Query Frame = 1
BLAST of Cp4.1LG01g17590 vs. NCBI nr
Match: gi|659109009|ref|XP_008454501.1| (PREDICTED: basic form of pathogenesis-related protein 1-like [Cucumis melo]) HSP 1 Score: 212.2 bits (539), Expect = 5.6e-52 Identity = 94/129 (72.87%), Postives = 111/129 (86.05%), Query Frame = 1
BLAST of Cp4.1LG01g17590 vs. NCBI nr
Match: gi|700193135|gb|KGN48339.1| (hypothetical protein Csa_6G483242 [Cucumis sativus]) HSP 1 Score: 211.5 bits (537), Expect = 9.6e-52 Identity = 92/121 (76.03%), Postives = 106/121 (87.60%), Query Frame = 1
BLAST of Cp4.1LG01g17590 vs. NCBI nr
Match: gi|700207817|gb|KGN62936.1| (hypothetical protein Csa_2G381380 [Cucumis sativus]) HSP 1 Score: 209.5 bits (532), Expect = 3.6e-51 Identity = 93/129 (72.09%), Postives = 106/129 (82.17%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |