CmaCh19G005440 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TGTTGTTCATTATTCGTAGTTTTATAGTTATTGCTCTCGTCTCTTTGTTTGGCAACGGAGAGAAGAGCAATCTGATCGTTCAAGCAATCTCAAGAGAAAAAGAGAGGAAAAAATGAGTTACTACAACCAGCCACCGCCTCCCGTCGGCGTTCCTCCGCCGCAAGGTAACATCTAAACCGATACTCTTACTTTTTCCCTTTCTTACTTCCGGCGCACTTTCTTTGATTTCTAAGGTTCAAATCGAATGGATCTTGCTGTCTTCTTCCACAAAATCTATTTAATCTTTGTTTTCGTTTCGATTTGACCGATTTTGGCTGCGATTCTGTGAATTTCGACGATTTTAGGTTATCCGCCGCAAGGATATCCGCCGAAGGACGCTTATCCACCACCAGGATATCCACCGCAGGGCGGTTATCCTCCTGCTGGTTATCCTCCGCAGGGATATCCGCCTCCGGCGTACGGACCACCTCAGCCTCAACATCCAAACCAAAAGAAAGAAGTTGGATTCGTCGAAGGCTGGTAAGTCTCTGCTTCTCTTTCATTTTACAACCTTAGTTGATGCGATTTCGTTGGCGTTTTCGAGTTGAAATTGAGTCCGTGCGTCTTCGCTGCGGCGAAGTACGGTTGCGGTTACCGATTAGTTGATTAATCCGTCTTCTGCG TGTTGTTCATTATTCGTAGTTTTATAGTTATTGCTCTCGTCTCTTTGTTTGGCAACGGAGAGAAGAGCAATCTGATCGTTCAAGCAATCTCAAGAGAAAAAGAGAGGAAAAAATGAGTTACTACAACCAGCCACCGCCTCCCGTCGGCGTTCCTCCGCCGCAAGGTTATCCGCCGCAAGGATATCCGCCGAAGGACGCTTATCCACCACCAGGATATCCACCGCAGGGCGGTTATCCTCCTGCTGGTTATCCTCCGCAGGGATATCCGCCTCCGGCGTACGGACCACCTCAGCCTCAACATCCAAACCAAAAGAAAGAAGTTGGATTCGTCGAAGGCTGGTAAGTCTCTGCTTCTCTTTCATTTTACAACCTTAGTTGATGCGATTTCGTTGGCGTTTTCGAGTTGAAATTGAGTCCGTGCGTCTTCGCTGCGGCGAAGTACGGTTGCGGTTACCGATTAGTTGATTAATCCGTCTTCTGCG ATGAGTTACTACAACCAGCCACCGCCTCCCGTCGGCGTTCCTCCGCCGCAAGGTTATCCGCCGCAAGGATATCCGCCGAAGGACGCTTATCCACCACCAGGATATCCACCGCAGGGCGGTTATCCTCCTGCTGGTTATCCTCCGCAGGGATATCCGCCTCCGGCGTACGGACCACCTCAGCCTCAACATCCAAACCAAAAGAAAGAAGTTGGATTCGTCGAAGGCTGGTAA MSYYNQPPPPVGVPPPQGYPPQGYPPKDAYPPPGYPPQGGYPPAGYPPQGYPPPAYGPPQPQHPNQKKEVGFVEGW
BLAST of CmaCh19G005440 vs. Swiss-Prot
Match: CYT1A_ARATH (Cysteine-rich and transmembrane domain-containing protein A OS=Arabidopsis thaliana GN=At2g41420 PE=3 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.1e-17 Identity = 57/86 (66.28%), Postives = 60/86 (69.77%), Query Frame = 1
BLAST of CmaCh19G005440 vs. Swiss-Prot
Match: OPSD_ENTDO (Rhodopsin OS=Enteroctopus dofleini GN=RHO PE=1 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 8.5e-10 Identity = 43/60 (71.67%), Postives = 45/60 (75.00%), Query Frame = 1
BLAST of CmaCh19G005440 vs. Swiss-Prot
Match: OPSD_LOLFO (Rhodopsin OS=Loligo forbesi GN=RHO PE=1 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 3.2e-09 Identity = 39/50 (78.00%), Postives = 39/50 (78.00%), Query Frame = 1
BLAST of CmaCh19G005440 vs. Swiss-Prot
Match: OPSD_ALLSU (Rhodopsin (Fragment) OS=Alloteuthis subulata GN=RHO PE=1 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 3.2e-09 Identity = 39/50 (78.00%), Postives = 39/50 (78.00%), Query Frame = 1
BLAST of CmaCh19G005440 vs. Swiss-Prot
Match: CYT1B_ARATH (Cysteine-rich and transmembrane domain-containing protein B OS=Arabidopsis thaliana GN=At3g57160 PE=3 SV=2) HSP 1 Score: 61.2 bits (147), Expect = 5.5e-09 Identity = 45/86 (52.33%), Postives = 48/86 (55.81%), Query Frame = 1
BLAST of CmaCh19G005440 vs. TrEMBL
Match: A0A0A0K2W8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G070830 PE=4 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 5.4e-27 Identity = 69/80 (86.25%), Postives = 69/80 (86.25%), Query Frame = 1
BLAST of CmaCh19G005440 vs. TrEMBL
Match: A0A0D2ST80_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G020000 PE=4 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.3e-20 Identity = 59/79 (74.68%), Postives = 61/79 (77.22%), Query Frame = 1
BLAST of CmaCh19G005440 vs. TrEMBL
Match: A0A0D2TVE9_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G020000 PE=4 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 3.1e-19 Identity = 58/78 (74.36%), Postives = 60/78 (76.92%), Query Frame = 1
BLAST of CmaCh19G005440 vs. TrEMBL
Match: M0TKV1_MUSAM (Uncharacterized protein OS=Musa acuminata subsp. malaccensis PE=4 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 7.0e-19 Identity = 58/77 (75.32%), Postives = 60/77 (77.92%), Query Frame = 1
BLAST of CmaCh19G005440 vs. TrEMBL
Match: A0A0B0MRS3_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_22046 PE=4 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 5.9e-18 Identity = 56/78 (71.79%), Postives = 59/78 (75.64%), Query Frame = 1
BLAST of CmaCh19G005440 vs. TAIR10
Match: AT2G41420.1 (AT2G41420.1 proline-rich family protein) HSP 1 Score: 90.1 bits (222), Expect = 6.3e-19 Identity = 57/86 (66.28%), Postives = 60/86 (69.77%), Query Frame = 1
BLAST of CmaCh19G005440 vs. TAIR10
Match: AT5G67600.1 (AT5G67600.1 unknown protein) HSP 1 Score: 60.8 bits (146), Expect = 4.1e-10 Identity = 43/73 (58.90%), Postives = 46/73 (63.01%), Query Frame = 1
BLAST of CmaCh19G005440 vs. TAIR10
Match: AT3G49845.1 (AT3G49845.1 unknown protein) HSP 1 Score: 55.5 bits (132), Expect = 1.7e-08 Identity = 40/75 (53.33%), Postives = 42/75 (56.00%), Query Frame = 1
BLAST of CmaCh19G005440 vs. TAIR10
Match: AT5G17650.1 (AT5G17650.1 glycine/proline-rich protein) HSP 1 Score: 55.5 bits (132), Expect = 1.7e-08 Identity = 37/62 (59.68%), Postives = 40/62 (64.52%), Query Frame = 1
BLAST of CmaCh19G005440 vs. TAIR10
Match: AT5G45350.1 (AT5G45350.1 proline-rich family protein) HSP 1 Score: 49.7 bits (117), Expect = 9.4e-07 Identity = 33/62 (53.23%), Postives = 35/62 (56.45%), Query Frame = 1
BLAST of CmaCh19G005440 vs. NCBI nr
Match: gi|778724815|ref|XP_011658867.1| (PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Cucumis sativus]) HSP 1 Score: 127.9 bits (320), Expect = 7.7e-27 Identity = 69/80 (86.25%), Postives = 69/80 (86.25%), Query Frame = 1
BLAST of CmaCh19G005440 vs. NCBI nr
Match: gi|659110097|ref|XP_008455047.1| (PREDICTED: CYSTM1 family protein A-like [Cucumis melo]) HSP 1 Score: 121.3 bits (303), Expect = 7.2e-25 Identity = 67/81 (82.72%), Postives = 67/81 (82.72%), Query Frame = 1
BLAST of CmaCh19G005440 vs. NCBI nr
Match: gi|763780233|gb|KJB47304.1| (hypothetical protein B456_008G020000 [Gossypium raimondii]) HSP 1 Score: 106.7 bits (265), Expect = 1.8e-20 Identity = 59/79 (74.68%), Postives = 61/79 (77.22%), Query Frame = 1
BLAST of CmaCh19G005440 vs. NCBI nr
Match: gi|823203355|ref|XP_012436114.1| (PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Gossypium raimondii]) HSP 1 Score: 102.1 bits (253), Expect = 4.5e-19 Identity = 58/78 (74.36%), Postives = 60/78 (76.92%), Query Frame = 1
BLAST of CmaCh19G005440 vs. NCBI nr
Match: gi|695046436|ref|XP_009411048.1| (PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Musa acuminata subsp. malaccensis]) HSP 1 Score: 100.9 bits (250), Expect = 1.0e-18 Identity = 58/77 (75.32%), Postives = 60/77 (77.92%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |