CmaCh17G012650 (gene) Cucurbita maxima (Rimu) | Cucurbit Genomics Database (CuGenDB)


Name	CmaCh17G012650
Type	gene
Organism	Cucurbita maxima (Cucurbita maxima (Rimu))
Description	Unknown protein
Location	Cma_Chr17 : 8609775 .. 8609915 (-)

The following sequences are available for this feature:

Legend: CDSexon

Hold the cursor over a type above to highlight its positions in the sequence below.

ATGACGGAGGCCGGCGACTGTCTAGACAGCTTCACACAGCCGCTGAAGGACCCATCGGCGCTGTCGGGCAACGGGGAGGCTATGGAAAATATTTGTAGTATCATCTTGGTTATAGCCAATCTTATTCTTGGGCTTGCCTAA

ATGACGGAGGCCGGCGACTGTCTAGACAGCTTCACACAGCCGCTGAAGGACCCATCGGCGCTGTCGGGCAACGGGGAGGCTATGGAAAATATTTGTAGTATCATCTTGGTTATAGCCAATCTTATTCTTGGGCTTGCCTAA

ATGACGGAGGCCGGCGACTGTCTAGACAGCTTCACACAGCCGCTGAAGGACCCATCGGCGCTGTCGGGCAACGGGGAGGCTATGGAAAATATTTGTAGTATCATCTTGGTTATAGCCAATCTTATTCTTGGGCTTGCCTAA

MTEAGDCLDSFTQPLKDPSALSGNGEAMENICSIILVIANLILGLA

The following BLAST results are available for this feature:


Match Name	E-value	Identity	Description


Match Name	E-value	Identity	Description


Match Name	E-value	Identity	Description


Match Name	E-value	Identity	Description

The following terms have been associated with this gene:

Vocabulary: **INTERPRO**
Term	Definition
IPR006501	Pectinesterase_inhib_dom

Vocabulary: **Molecular Function**
Term	Definition
GO:0004857	enzyme inhibitor activity

GO Assignments

This gene is annotated with the following GO terms.

The following mRNA feature(s) are a part of this gene:


Feature Name	Unique Name	Type
CmaCh17G012650.1	CmaCh17G012650.1	mRNA

Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
IPR006501	Pectinesterase inhibitor domain	GENE3D	G3DSA:1.20.140.40		coord: 1..42 score: 8.

The following gene(s) are orthologous to this gene:


Gene	Orthologue	Organism	Block
CmaCh17G012650	CmoCh17G012380	Cucurbita moschata (Rifu)	cmacmoB353

The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene: