CmaCh07G013490 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTCTAGCATCCGAAGAAAGATCAAAGCTAAACCCGAACGCTCCGCTTTTCATCCCGGCCGCCTACCAGGTGGAGGATTTCTCTCCACAATGGTGGCAACTGGTCACAACCTCGACATGGTACCACGACTACTGGCTGAGCCAACACCAAGAAGAGAGCGACTTCTCTTTGAATAGCGAAGACGATTATGACATTGCTGAATTTCTGCCACTGGCCTTAGATCTTGAAGGCAACGAAGAGCTCCGCACCATGGAAGCTGAATTCGAGGAGTTTATTCAAGCTTCTCTCAATGAAGGGACCCAAGAACTTCCTTAA ATGTCTCTAGCATCCGAAGAAAGATCAAAGCTAAACCCGAACGCTCCGCTTTTCATCCCGGCCGCCTACCAGGTGGAGGATTTCTCTCCACAATGGTGGCAACTGGTCACAACCTCGACATGGTACCACGACTACTGGCTGAGCCAACACCAAGAAGAGAGCGACTTCTCTTTGAATAGCGAAGACGATTATGACATTGCTGAATTTCTGCCACTGGCCTTAGATCTTGAAGGCAACGAAGAGCTCCGCACCATGGAAGCTGAATTCGAGGAGTTTATTCAAGCTTCTCTCAATGAAGGGACCCAAGAACTTCCTTAA ATGTCTCTAGCATCCGAAGAAAGATCAAAGCTAAACCCGAACGCTCCGCTTTTCATCCCGGCCGCCTACCAGGTGGAGGATTTCTCTCCACAATGGTGGCAACTGGTCACAACCTCGACATGGTACCACGACTACTGGCTGAGCCAACACCAAGAAGAGAGCGACTTCTCTTTGAATAGCGAAGACGATTATGACATTGCTGAATTTCTGCCACTGGCCTTAGATCTTGAAGGCAACGAAGAGCTCCGCACCATGGAAGCTGAATTCGAGGAGTTTATTCAAGCTTCTCTCAATGAAGGGACCCAAGAACTTCCTTAA MSLASEERSKLNPNAPLFIPAAYQVEDFSPQWWQLVTTSTWYHDYWLSQHQEESDFSLNSEDDYDIAEFLPLALDLEGNEELRTMEAEFEEFIQASLNEGTQELP
BLAST of CmaCh07G013490 vs. Swiss-Prot
Match: ERD15_ARATH (Protein EARLY RESPONSIVE TO DEHYDRATION 15 OS=Arabidopsis thaliana GN=ERD15 PE=1 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 8.1e-19 Identity = 53/99 (53.54%), Postives = 69/99 (69.70%), Query Frame = 1
BLAST of CmaCh07G013490 vs. Swiss-Prot
Match: CID2_ARATH (Polyadenylate-binding protein-interacting protein 2 OS=Arabidopsis thaliana GN=CID2 PE=2 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 5.7e-12 Identity = 40/89 (44.94%), Postives = 50/89 (56.18%), Query Frame = 1
BLAST of CmaCh07G013490 vs. TrEMBL
Match: Q6ELF8_CUCSA (Poly(A)-binding protein C-terminal interacting protein 243 OS=Cucumis sativus GN=Csa_4G214830 PE=2 SV=1) HSP 1 Score: 165.6 bits (418), Expect = 3.2e-38 Identity = 87/105 (82.86%), Postives = 92/105 (87.62%), Query Frame = 1
BLAST of CmaCh07G013490 vs. TrEMBL
Match: W9S851_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_015513 PE=4 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 8.7e-28 Identity = 64/102 (62.75%), Postives = 78/102 (76.47%), Query Frame = 1
BLAST of CmaCh07G013490 vs. TrEMBL
Match: A0A061EXG3_THECC (Dehydration-induced protein, putative OS=Theobroma cacao GN=TCM_024484 PE=4 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 2.2e-26 Identity = 66/104 (63.46%), Postives = 77/104 (74.04%), Query Frame = 1
BLAST of CmaCh07G013490 vs. TrEMBL
Match: A0A165YEK0_DAUCA (Uncharacterized protein OS=Daucus carota subsp. sativus GN=DCAR_013620 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 2.8e-26 Identity = 62/98 (63.27%), Postives = 79/98 (80.61%), Query Frame = 1
BLAST of CmaCh07G013490 vs. TrEMBL
Match: A0A067K1V9_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_22456 PE=4 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 6.3e-26 Identity = 61/100 (61.00%), Postives = 76/100 (76.00%), Query Frame = 1
BLAST of CmaCh07G013490 vs. TAIR10
Match: AT2G41430.1 (AT2G41430.1 dehydration-induced protein (ERD15)) HSP 1 Score: 94.4 bits (233), Expect = 4.6e-20 Identity = 53/99 (53.54%), Postives = 69/99 (69.70%), Query Frame = 1
BLAST of CmaCh07G013490 vs. TAIR10
Match: AT4G14270.1 (AT4G14270.1 Protein containing PAM2 motif which mediates interaction with the PABC domain of polyadenyl binding proteins.) HSP 1 Score: 71.6 bits (174), Expect = 3.2e-13 Identity = 40/89 (44.94%), Postives = 50/89 (56.18%), Query Frame = 1
BLAST of CmaCh07G013490 vs. NCBI nr
Match: gi|525507437|ref|NP_001267508.1| (protein EARLY RESPONSIVE TO DEHYDRATION 15-like [Cucumis sativus]) HSP 1 Score: 165.6 bits (418), Expect = 4.6e-38 Identity = 87/105 (82.86%), Postives = 92/105 (87.62%), Query Frame = 1
BLAST of CmaCh07G013490 vs. NCBI nr
Match: gi|703123054|ref|XP_010102715.1| (hypothetical protein L484_015513 [Morus notabilis]) HSP 1 Score: 131.0 bits (328), Expect = 1.3e-27 Identity = 64/102 (62.75%), Postives = 78/102 (76.47%), Query Frame = 1
BLAST of CmaCh07G013490 vs. NCBI nr
Match: gi|590635295|ref|XP_007028595.1| (Dehydration-induced protein, putative [Theobroma cacao]) HSP 1 Score: 126.3 bits (316), Expect = 3.1e-26 Identity = 66/104 (63.46%), Postives = 77/104 (74.04%), Query Frame = 1
BLAST of CmaCh07G013490 vs. NCBI nr
Match: gi|1021041237|gb|KZM99018.1| (hypothetical protein DCAR_013620 [Daucus carota subsp. sativus]) HSP 1 Score: 125.9 bits (315), Expect = 4.0e-26 Identity = 62/98 (63.27%), Postives = 79/98 (80.61%), Query Frame = 1
BLAST of CmaCh07G013490 vs. NCBI nr
Match: gi|802725118|ref|XP_012085962.1| (PREDICTED: protein EARLY RESPONSIVE TO DEHYDRATION 15 [Jatropha curcas]) HSP 1 Score: 124.8 bits (312), Expect = 9.0e-26 Identity = 61/100 (61.00%), Postives = 76/100 (76.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|