Cla97C07G140880 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAAGATTGGTTGTGGAGAAGTATAGCGTAGTGGGGATCAGGTATGGAGGGTACGTGGCATATCGGATGGCTGAGATTCATCAGGAAGTGACGAAGGTTGTGATTGTGAGCTGTGGAATATGTAGTAGTGATGATCAAAAGTTGGAGCAGCTTAAGAAGATAGGAAGGGATGCAGTGAATCTTCTTGTATTAGAAACACCACAAGATTTGAAGACTCTGATGAAGTTGTCTATAGACAAATATGATCCAAGTTGGTTGCCAGATTGCATGGTTTCTGTTTCTGTTCTAACGATTGCATGGTTTCTGTATTCTGTTCATTGA ATGAAAAGATTGGTTGTGGAGAAGTATAGCGTAGTGGGGATCAGGTATGGAGGGTACGTGGCATATCGGATGGCTGAGATTCATCAGGAAGTGACGAAGGTTGTGATTGTGAGCTGTGGAATATGTAGTAGTGATGATCAAAAGTTGGAGCAGCTTAAGAAGATAGGAAGGGATGCAGTGAATCTTCTTGTATTAGAAACACCACAAGATTTGAAGACTCTGATGAAGTTGTCTATAGACAAATATGATCCAAGTTGGTTGCCAGATTGCATGGTTTCTGTTTCTGTTCTAACGATTGCATGGTTTCTGTATTCTGTTCATTGA ATGAAAAGATTGGTTGTGGAGAAGTATAGCGTAGTGGGGATCAGGTATGGAGGGTACGTGGCATATCGGATGGCTGAGATTCATCAGGAAGTGACGAAGGTTGTGATTGTGAGCTGTGGAATATGTAGTAGTGATGATCAAAAGTTGGAGCAGCTTAAGAAGATAGGAAGGGATGCAGTGAATCTTCTTGTATTAGAAACACCACAAGATTTGAAGACTCTGATGAAGTTGTCTATAGACAAATATGATCCAAGTTGGTTGCCAGATTGCATGGTTTCTGTTTCTGTTCTAACGATTGCATGGTTTCTGTATTCTGTTCATTGA MKRLVVEKYSVVGIRYGGYVAYRMAEIHQEVTKVVIVSCGICSSDDQKLEQLKKIGRDAVNLLVLETPQDLKTLMKLSIDKYDPSWLPDCMVSVSVLTIAWFLYSVH
BLAST of Cla97C07G140880 vs. NCBI nr
Match: KVH97888.1 (Alpha/beta hydrolase fold-1 [Cynara cardunculus var. scolymus]) HSP 1 Score: 105.9 bits (263), Expect = 8.6e-20 Identity = 53/91 (58.24%), Postives = 71/91 (78.02%), Query Frame = 0
BLAST of Cla97C07G140880 vs. NCBI nr
Match: GAV82711.1 (Abhydrolase_6 domain-containing protein [Cephalotus follicularis]) HSP 1 Score: 105.9 bits (263), Expect = 8.6e-20 Identity = 52/101 (51.49%), Postives = 76/101 (75.25%), Query Frame = 0
BLAST of Cla97C07G140880 vs. NCBI nr
Match: XP_024972171.1 (uncharacterized protein LOC112511033 [Cynara cardunculus var. scolymus]) HSP 1 Score: 105.9 bits (263), Expect = 8.6e-20 Identity = 53/91 (58.24%), Postives = 71/91 (78.02%), Query Frame = 0
BLAST of Cla97C07G140880 vs. NCBI nr
Match: XP_015903034.1 (uncharacterized protein LOC107435914 [Ziziphus jujuba]) HSP 1 Score: 104.4 bits (259), Expect = 2.5e-19 Identity = 54/91 (59.34%), Postives = 72/91 (79.12%), Query Frame = 0
BLAST of Cla97C07G140880 vs. NCBI nr
Match: XP_015865697.1 (uncharacterized protein LOC107403324 [Ziziphus jujuba]) HSP 1 Score: 104.4 bits (259), Expect = 2.5e-19 Identity = 54/91 (59.34%), Postives = 72/91 (79.12%), Query Frame = 0
BLAST of Cla97C07G140880 vs. TrEMBL
Match: tr|A0A103XVZ5|A0A103XVZ5_CYNCS (Alpha/beta hydrolase fold-1 OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_023858 PE=4 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 5.7e-20 Identity = 53/91 (58.24%), Postives = 71/91 (78.02%), Query Frame = 0
BLAST of Cla97C07G140880 vs. TrEMBL
Match: tr|A0A1Q3CRG1|A0A1Q3CRG1_CEPFO (Abhydrolase_6 domain-containing protein OS=Cephalotus follicularis OX=3775 GN=CFOL_v3_26162 PE=4 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 5.7e-20 Identity = 52/101 (51.49%), Postives = 76/101 (75.25%), Query Frame = 0
BLAST of Cla97C07G140880 vs. TrEMBL
Match: tr|A0A251UV85|A0A251UV85_HELAN (Putative alpha/beta-Hydrolases superfamily protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr04g0094701 PE=4 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 4.8e-19 Identity = 51/94 (54.26%), Postives = 71/94 (75.53%), Query Frame = 0
BLAST of Cla97C07G140880 vs. TrEMBL
Match: tr|A0A059AHN6|A0A059AHN6_EUCGR (Uncharacterized protein OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_J02811 PE=4 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 1.8e-18 Identity = 54/91 (59.34%), Postives = 69/91 (75.82%), Query Frame = 0
BLAST of Cla97C07G140880 vs. TrEMBL
Match: tr|B9S5Q5|B9S5Q5_RICCO (Abhydrolase domain containing, putative OS=Ricinus communis OX=3988 GN=RCOM_0652430 PE=4 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 6.9e-18 Identity = 52/96 (54.17%), Postives = 73/96 (76.04%), Query Frame = 0
BLAST of Cla97C07G140880 vs. TAIR10
Match: AT1G17430.1 (alpha/beta-Hydrolases superfamily protein) HSP 1 Score: 67.4 bits (163), Expect = 6.1e-12 Identity = 39/87 (44.83%), Postives = 55/87 (63.22%), Query Frame = 0
BLAST of Cla97C07G140880 vs. TAIR10
Match: AT1G72620.1 (alpha/beta-Hydrolases superfamily protein) HSP 1 Score: 65.9 bits (159), Expect = 1.8e-11 Identity = 37/87 (42.53%), Postives = 57/87 (65.52%), Query Frame = 0
BLAST of Cla97C07G140880 vs. TAIR10
Match: AT2G18360.1 (alpha/beta-Hydrolases superfamily protein) HSP 1 Score: 53.1 bits (126), Expect = 1.2e-07 Identity = 31/90 (34.44%), Postives = 56/90 (62.22%), Query Frame = 0
BLAST of Cla97C07G140880 vs. TAIR10
Match: AT5G09430.1 (alpha/beta-Hydrolases superfamily protein) HSP 1 Score: 50.4 bits (119), Expect = 7.7e-07 Identity = 26/79 (32.91%), Postives = 47/79 (59.49%), Query Frame = 0
BLAST of Cla97C07G140880 vs. TAIR10
Match: AT4G39955.1 (alpha/beta-Hydrolases superfamily protein) HSP 1 Score: 48.9 bits (115), Expect = 2.3e-06 Identity = 27/88 (30.68%), Postives = 49/88 (55.68%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |